close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287, git build 6599622)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Smoldering Heart (effect#2) base_value 10.00 20.00
Lava Burst (effect#1) sp_coefficient 2.83 2.75
Lava Burst Overload (effect#1) sp_coefficient 2.83 2.75
Chain Lightning (effect#1) sp_coefficient 1.65 1.60
Chain Lightning Overload (effect#1) sp_coefficient 1.65 1.60
Lightning Bolt (effect#1) sp_coefficient 1.80 1.75
Lightning Bolt Overload (effect#1) sp_coefficient 1.80 1.75
Earth Shock (effect#1) sp_coefficient 11.85 11.50
Flame Shock (effect#1) sp_coefficient 0.82 0.80
Flame Shock (effect#2) sp_coefficient 0.41 0.40
Frost Shock (effect#1) sp_coefficient 0.82 0.80
Elemental Blast (effect#1) sp_coefficient 7.00 6.80
Elemental Blast Overload (effect#1) sp_coefficient 7.00 6.80
Icefury (effect#1) sp_coefficient 9.27 9.00
Icefury Overload (effect#1) sp_coefficient 9.27 9.00
Earthen Rage (effect#1) sp_coefficient 0.57 0.55
Liquid Magma (effect#1) sp_coefficient 1.13 1.10
Seismic Lightning (effect#1) sp_coefficient 7.21 7.00
Volcanic Inferno (effect#1) sp_coefficient 0.62 0.60
Lightning Blast (effect#1) sp_coefficient 2.06 2.00
Chain Lightning (effect#1) sp_coefficient 0.52 0.50
Fire Blast (effect#1) sp_coefficient 2.78 2.70
Call Lightning (effect#1) sp_coefficient 1.24 1.20
Wind Gust (effect#1) sp_coefficient 0.62 0.60
Fire Blast (effect#1) sp_coefficient 2.78 2.70
Immolate (effect#1) sp_coefficient 0.31 0.30
Immolate (effect#2) sp_coefficient 0.82 0.80
Fire Nova (effect#1) sp_coefficient 1.03 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Charm + Sentinel : 1289695 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1289694.9 1289694.9 852.4 / 0.066% 268742.7 / 20.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Sentinel 1289695
Earth Shock 284041 22.0% 51.7 5.67sec 1648997 1580019 Direct 51.7 1199085 3445332 1648992 20.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.68 51.68 0.00 0.00 1.0437 0.0000 85211987.04 85211987.04 0.00 1580018.67 1580018.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.33 79.97% 1199085.44 741258 1619485 1198638.03 995140 1373790 49552745 49552745 0.00
crit 10.35 20.03% 3445332.10 2128892 4651160 3443544.33 2329616 4590980 35659242 35659242 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 125055 9.7% 11.3 27.14sec 3311495 3220414 Direct 11.3 90020 262765 216544 73.2%  
Periodic 217.4 49611 198867 161290 74.8% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 217.40 217.40 1.0283 1.3718 37517819.60 37517819.60 0.00 121077.17 3220413.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.03 26.76% 90019.89 80604 98616 89713.75 0 98616 272905 272905 0.00
crit 8.30 73.24% 262764.87 231494 283226 262823.85 250240 274438 2180408 2180408 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.7 25.18% 49611.32 198 54240 49621.31 46164 51691 2715237 2715237 0.00
crit 162.7 74.82% 198867.31 145 218088 198885.25 190671 206021 32349270 32349270 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 309982 (471797) 24.0% (36.6%) 98.6 3.02sec 1436081 1126852 Direct 98.3 0 945635 945635 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.56 98.34 0.00 0.00 1.2744 0.0000 92994860.04 92994860.04 0.00 1126852.40 1126852.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.34 100.00% 945635.32 763198 1137266 944258.78 874275 1008563 92994860 92994860 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 147737 11.5% 59.0 5.00sec 751561 0 Direct 58.8 0 753679 753679 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.97 58.81 0.00 0.00 0.0000 0.0000 44321020.59 44321020.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.81 100.00% 753678.97 608226 906338 752589.55 693244 812555 44321021 44321021 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14078 1.1% 73.3 3.84sec 57628 0 Direct 73.3 47703 97307 57628 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.29 73.29 0.00 0.00 0.0000 0.0000 4223541.71 4223541.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.62 79.99% 47702.73 45803 50943 47702.31 46218 50292 2796545 2796545 0.00
crit 14.66 20.01% 97307.31 93438 103925 97309.19 93438 103348 1426997 1426997 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 83373 (158115) 6.5% (12.3%) 73.2 4.02sec 647980 482854 Direct 73.2 248384 714535 341688 20.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.20 73.20 0.00 0.00 1.3420 0.0000 25011685.47 25011685.47 0.00 482853.83 482853.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.55 79.98% 248383.84 159755 586370 249649.40 197109 333644 14543386 14543386 0.00
crit 14.65 20.02% 714534.67 458817 1684055 717349.82 475048 1326973 10468300 10468300 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 74741 5.8% 75.8 5.01sec 295682 0 Direct 75.8 214693 617426 295673 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.83 75.83 0.00 0.00 0.0000 0.0000 22421943.33 22421943.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.58 79.89% 214693.45 134194 492551 215436.50 157938 305428 13006509 13006509 0.00
crit 15.25 20.11% 617426.25 385406 1414606 619405.38 402261 1210284 9415434 9415434 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (62682) 0.0% (4.9%) 3.0 120.46sec 6267853 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 313392.67 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19697 1.5% 36.1 7.37sec 163641 0 Direct 36.1 135409 276235 163643 20.0%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.11 36.11 0.00 0.00 0.0000 0.0000 5908682.44 5908682.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.87 79.95% 135409.19 135409 135409 135409.19 135409 135409 3909149 3909149 0.00
crit 7.24 20.05% 276234.76 276235 276235 276057.96 0 276235 1999533 1999533 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 42986 3.3% 91.9 2.86sec 140280 0 Direct 91.9 116064 236771 140279 20.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.92 91.92 0.00 0.00 0.0000 0.0000 12894877.80 12894877.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.48 79.94% 116064.33 116064 116064 116064.33 116064 116064 8528613 8528613 0.00
crit 18.44 20.06% 236771.23 236771 236771 236771.23 236771 236771 4366265 4366265 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - primal_fire_elemental 246342 / 164337
Fire Blast 212848 11.0% 91.2 3.24sec 467224 234144 Direct 91.2 389107 778157 467234 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.18 91.18 0.00 0.00 1.9955 0.0000 42602559.63 42602559.63 0.00 234144.32 234144.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.87 79.92% 389107.12 370953 412592 389137.67 380797 401828 28355690 28355690 0.00
crit 18.31 20.08% 778157.02 741905 825185 778210.34 746481 813851 14246869 14246869 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 33494 1.7% 10.3 30.66sec 651351 463662 Direct 10.3 115112 230217 138274 20.1%  
Periodic 106.2 41373 82766 49680 20.1% 68.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 106.24 106.24 1.4049 1.9404 6700373.49 6700373.49 0.00 30374.51 463661.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.22 79.87% 115112.01 109912 122250 115119.88 109912 121301 945822 945822 0.00
crit 2.07 20.13% 230217.22 219824 244499 206980.89 0 244499 476622 476622 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.9 79.93% 41373.09 21 45844 41375.62 39948 43286 3513219 3513219 0.00
crit 21.3 20.07% 82765.76 42 91687 82764.37 66331 89315 1764710 1764710 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177500 / 23668
Lightning Blast 177500 1.8% 37.2 7.00sec 190990 186950 Direct 37.2 159001 318067 190997 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.17 37.17 0.00 0.00 1.0216 0.0000 7099996.66 7099996.66 0.00 186950.25 186950.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.70 79.89% 159000.64 152655 169791 159000.81 154303 166056 4722071 4722071 0.00
crit 7.48 20.11% 318066.98 305311 339582 317974.89 0 339582 2377925 2377925 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Sentinel
Ascendance 2.0 185.36sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 99.86sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 1.0865 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.66sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8771 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.56sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.6sec 49.6sec 27.75% 48.10% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.2 50.5 4.5sec 2.5sec 66.69% 71.50% 50.5(58.2) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.97%
  • elemental_focus_2:37.71%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.0 0.7 13.8sec 13.3sec 8.03% 23.34% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.03%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.97% 29.97% 4.3(4.3) 12.6

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.7sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.7sec 19.1sec 38.33% 34.35% 6.3(17.4) 0.7

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.21%
  • power_of_the_maelstrom_2:6.17%
  • power_of_the_maelstrom_3:25.95%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 94.0sec 94.0sec 25.55% 25.55% 40.2(40.2) 3.1

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.21% 11.29% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.16%
  • stormkeeper_2:3.05%
  • stormkeeper_3:4.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 99.05% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.7 13.3sec
Lava Surge: Wasted 0.8 82.3sec
Lava Surge: During Lava Burst 7.8 34.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6670.0007.4622.2630.0009.614
Fire Elemental0.4070.0011.4790.5830.0004.163
Ascendance5.6950.00184.5915.6180.00084.591
Lava Burst0.7990.0009.0255.3120.00021.860

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Sentinel
earth_shock Maelstrom 51.7 5238.3 101.4 101.4 16267.0
flame_shock Maelstrom 11.3 207.6 18.3 18.3 180728.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.56 1154.02 (20.97%) 11.71 28.64 2.42%
Lava Burst Overload Maelstrom 58.97 503.34 (9.15%) 8.54 27.38 5.16%
Lightning Bolt Maelstrom 73.21 585.65 (10.64%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 75.83 451.85 (8.21%) 5.96 3.15 0.69%
Aftershock Maelstrom 63.01 1633.78 (29.69%) 25.93 0.00 0.00%
Resonance Totem Maelstrom 298.59 290.54 (5.28%) 0.97 8.05 2.70%
The Deceiver's Blood Pact Maelstrom 10.36 883.15 (16.05%) 85.28 166.55 15.87%
Resource RPS-Gain RPS-Loss
Maelstrom 18.34 18.15
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.35 11.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Charm + Sentinel Damage Per Second
Count 24999
Mean 1289694.93
Minimum 1033362.62
Maximum 1557973.64
Spread ( max - min ) 524611.02
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 68761.7185
5th Percentile 1178948.94
95th Percentile 1403970.91
( 95th Percentile - 5th Percentile ) 225021.97
Mean Distribution
Standard Deviation 434.8960
95.00% Confidence Intervall ( 1288842.55 - 1290547.31 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 110
0.1% Error 10920
0.1 Scale Factor Error with Delta=300 40362413
0.05 Scale Factor Error with Delta=300 161449649
0.01 Scale Factor Error with Delta=300 4036241219
Priority Target DPS
Sample Data Charm + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1289694.93
Minimum 1033362.62
Maximum 1557973.64
Spread ( max - min ) 524611.02
Range [ ( max - min ) / 2 * 100% ] 20.34%
Standard Deviation 68761.7185
5th Percentile 1178948.94
95th Percentile 1403970.91
( 95th Percentile - 5th Percentile ) 225021.97
Mean Distribution
Standard Deviation 434.8960
95.00% Confidence Intervall ( 1288842.55 - 1290547.31 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 110
0.1% Error 10920
0.1 Scale Factor Error with Delta=300 40362413
0.05 Scale Factor Error with Delta=300 161449649
0.01 Scale Factor Error with Delta=300 4036241219
DPS(e)
Sample Data Charm + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1289694.93
Minimum 1033362.62
Maximum 1557973.64
Spread ( max - min ) 524611.02
Range [ ( max - min ) / 2 * 100% ] 20.34%
Damage
Sample Data Charm + Sentinel Damage
Count 24999
Mean 330506418.04
Minimum 259151448.66
Maximum 404001039.04
Spread ( max - min ) 144849590.38
Range [ ( max - min ) / 2 * 100% ] 21.91%
DTPS
Sample Data Charm + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.52 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.99 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.40 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.84 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.75 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.69 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.62 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 48.56 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLLLLKKIKLLLLILLLLLAILLLLLHLILLLLFLILLLLILLLLILLNLPPNILJKLLGLLIL97LKKIILLLNPQQLNAIMQQQLLNPPPLLILPONPLLPNMPLJKLNQQQLLNQQQLNQAQQNLQMQQNLQQNQQLLNQQQLNQLQML9ANNJKKKLNQQQQLNIQQLHLNOQQQLLNILLLLILLLLHLIILLLFLILLLLIJKKKLILLLLLILALMPPNPLPNPPQLNI9AQQLMNQQQQLLII

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides
0:03.081 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
0:03.899 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
0:04.708 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:05.771 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, ascendance, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
0:06.822 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom bloodlust, ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
0:07.859 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:08.884 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(8)
0:09.646 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.3/125: 83% maelstrom bloodlust, ascendance, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(9)
0:10.413 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.3/125: 95% maelstrom bloodlust, ascendance, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:11.171 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:11.930 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:12.940 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:13.951 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:14.960 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:15.970 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:16.724 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.716 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.709 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.702 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:21.684 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.684 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.540 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.820 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.960 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.8/125: 76% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.816 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.8/125: 93% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.956 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.812 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.952 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.946 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.086 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.226 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.367 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.367 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.507 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.364 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.219 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.075 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.213 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.351 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.1/125: 94% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.463 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.2/125: 54% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.058 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.2/125: 65% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.538 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.2/125: 83% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.019 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.131 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.612 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.096 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.207 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.318 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.800 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.4/125: 53% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.282 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.394 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.506 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.985 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.095 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.207 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.688 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom ascendance, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.170 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.282 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.393 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.872 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.960 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:12.413 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:13.502 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:13.502 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:14.593 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.6/125: 74% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:15.683 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 113.6/125: 91% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:16.771 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:17.881 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:18.992 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:20.473 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:21.586 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:23.067 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.178 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.659 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.139 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.620 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.102 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.212 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 118.6/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.212 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.6/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
1:32.308 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
1:33.391 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(3)
1:34.817 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
1:36.224 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
1:37.597 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
1:38.954 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
1:39.962 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
1:40.955 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:42.267 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:43.555 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:44.845 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:45.812 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:46.779 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:47.748 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:49.060 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:50.347 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 69.3/125: 55% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:51.101 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:52.070 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.6/125: 20% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:53.522 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:54.612 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.6/125: 44% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.065 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:57.516 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.605 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.695 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.146 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.236 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.325 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.414 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.864 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.7/125: 73% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.975 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.087 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.7/125: 42% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.199 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.792 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.273 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.7/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.385 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:15.867 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:17.348 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:18.828 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.4/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.310 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.4/125: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.421 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.902 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.902 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.383 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.864 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:26.952 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:28.403 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.853 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:30.943 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.394 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.875 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.9/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.988 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.468 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.919 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:39.370 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.460 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:41.912 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.392 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.871 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:45.963 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.8/125: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.053 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.504 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.955 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.408 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.3/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:52.859 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.3/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.971 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.8/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.451 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.8/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.563 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.045 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.156 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.637 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.750 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.750 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
3:02.845 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.4/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(2)
3:03.909 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 29.9/125: 24% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(3)
3:04.961 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(4)
3:05.998 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.9/125: 42% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(5)
3:07.022 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
3:08.034 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.9/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
3:09.392 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.9/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
3:10.398 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
3:11.726 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:13.038 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:14.348 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:15.659 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:16.971 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.2/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:17.956 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.6/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:18.942 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:20.252 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:21.564 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:22.550 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.8/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.661 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.143 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.8/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.232 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.985 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.435 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:29.888 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:31.342 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.453 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.1/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.933 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.1/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.045 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.157 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.269 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.381 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.861 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.972 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.562 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.040 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.520 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.9/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.000 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.9/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.110 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.9/125: 84% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.590 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.9/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.701 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.814 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.294 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.775 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.256 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.256 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.736 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.849 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.959 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.438 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.917 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:05.369 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.2/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.460 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.550 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.638 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.727 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.6/125: 71% maelstrom ascendance, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.817 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.6/125: 83% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.269 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.6/125: 94% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.358 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.808 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.7/125: 47% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.259 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.711 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.7/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.191 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.7/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.669 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.260 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.260 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.741 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.851 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.331 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.810 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.921 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.401 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.852 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.305 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.394 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.5/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:36.845 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.5/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.298 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:39.779 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:41.260 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:42.371 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.483 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.594 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.594 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides
4:46.055 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
4:47.497 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(3)
4:48.924 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
4:49.967 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
4:51.000 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:52.357 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
4:53.699 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.2/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:55.011 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:56.323 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:57.610 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.2/125: 71% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:58.577 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.2/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:59.543 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Terror : 1285799 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1285799.3 1285799.3 882.9 / 0.069% 277470.9 / 21.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Terror 1285799
Earth Shock 289068 22.5% 50.5 5.77sec 1716557 1646714 Direct 50.5 1194337 3429256 1716595 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.52 50.52 0.00 0.00 1.0424 0.0000 86719261.13 86719261.13 0.00 1646714.16 1646714.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.71 76.63% 1194337.48 741258 1619485 1193930.69 1005303 1376414 46238030 46238030 0.00
crit 11.80 23.37% 3429256.10 2128892 4651160 3427554.97 2411978 4433922 40481231 40481231 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 127079 9.9% 11.3 27.11sec 3366089 3268293 Direct 11.3 90096 262688 219722 75.1%  
Periodic 217.7 49652 198314 163674 76.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 217.73 217.73 1.0299 1.3693 38124634.20 38124634.20 0.00 123059.70 3268292.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.82 24.90% 90096.31 80604 98616 89404.21 0 98616 254099 254099 0.00
crit 8.51 75.10% 262687.71 231494 283226 262743.76 249689 274123 2234374 2234374 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.7 23.30% 49651.79 106 54240 49660.31 46396 51583 2518912 2518912 0.00
crit 167.0 76.70% 198314.21 157 218088 198329.26 191166 205226 33117249 33117249 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 315059 (461177) 24.5% (35.9%) 98.6 3.01sec 1403250 1103165 Direct 98.4 0 960594 960594 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.59 98.39 0.00 0.00 1.2720 0.0000 94516269.93 94516269.93 0.00 1103165.13 1103165.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.39 100.00% 960593.89 763198 1168080 959056.75 889960 1026204 94516270 94516270 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 131600 10.2% 51.7 5.69sec 763712 0 Direct 51.6 0 765662 765662 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.69 51.56 0.00 0.00 0.0000 0.0000 39479587.57 39479587.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.56 100.00% 765662.25 608226 930895 764434.99 690153 825389 39479588 39479588 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14518 1.1% 73.5 3.83sec 59259 0 Direct 73.5 47692 97299 59259 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.50 73.50 0.00 0.00 0.0000 0.0000 4355390.37 4355390.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.36 76.68% 47692.24 45803 50943 47693.06 46147 49828 2687897 2687897 0.00
crit 17.14 23.32% 97299.03 93438 103925 97302.11 93438 103588 1667494 1667494 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 88360 (161538) 6.9% (12.6%) 74.4 3.95sec 651508 486379 Direct 74.4 247690 713016 356381 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.38 74.38 0.00 0.00 1.3395 0.0000 26507603.20 26507603.20 0.00 486378.70 486378.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.01 76.64% 247689.62 159755 586370 248896.59 200077 347709 14120374 14120374 0.00
crit 17.37 23.36% 713016.21 458817 1684055 716099.30 481758 1337065 12387230 12387230 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73177 5.7% 71.2 5.24sec 308282 0 Direct 71.2 214396 617279 308302 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.21 71.21 0.00 0.00 0.0000 0.0000 21952738.47 21952738.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.61 76.69% 214395.92 134194 492551 215098.33 160058 312884 11709120 11709120 0.00
crit 16.60 23.31% 617278.54 385406 1414606 619045.85 406147 1205206 10243619 10243619 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 50920 4.0% 9.9 28.62sec 1536715 0 Direct 9.9 1233906 2517168 1536773 23.6%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.94 9.94 0.00 0.00 0.0000 0.0000 15276047.96 15276047.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.60 76.40% 1233905.72 1233906 1233906 1233807.00 0 1233906 9371543 9371543 0.00
crit 2.35 23.60% 2517167.67 2517168 2517168 2299977.75 0 2517168 5904505 5904505 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 253042 / 171700
Fire Blast 218763 11.5% 92.8 3.19sec 479749 240544 Direct 92.8 388892 777770 479753 23.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.83 92.83 0.00 0.00 1.9944 0.0000 44535776.42 44535776.42 0.00 240544.09 240544.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.14 76.64% 388891.87 370953 412592 388922.15 380021 399592 27666807 27666807 0.00
crit 21.69 23.36% 777770.15 741905 825185 777834.26 753706 815932 16868970 16868970 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34279 1.8% 10.4 30.23sec 669105 476886 Direct 10.4 115041 230116 141869 23.3%  
Periodic 107.8 41332 82655 50964 23.3% 69.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.42 10.42 107.85 107.85 1.4031 1.9377 6975405.21 6975405.21 0.00 31195.07 476885.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.99 76.68% 115040.62 109912 122250 115049.28 110703 122250 919627 919627 0.00
crit 2.43 23.32% 230116.08 219824 244499 216006.77 0 244499 559429 559429 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.7 76.69% 41332.13 21 45844 41335.37 39733 43117 3418613 3418613 0.00
crit 25.1 23.31% 82655.45 42 91687 82663.16 71313 89374 2077737 2077737 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182363 / 24317
Lightning Blast 182363 1.9% 37.2 7.00sec 196250 192093 Direct 37.2 158993 318031 196255 23.4%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.17 37.17 0.00 0.00 1.0217 0.0000 7294533.63 7294533.63 0.00 192092.84 192092.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.46 76.57% 158992.62 152655 169791 158994.87 154375 166597 4525313 4525313 0.00
crit 8.71 23.43% 318031.18 305311 339582 318016.61 305311 339582 2769220 2769220 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Terror
Ascendance 2.0 185.35sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 98.11sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 1.0832 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.62sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8771 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.53sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.0sec 50.0sec 27.31% 47.88% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.0sec 32.15% 32.15% 3.0(3.0) 8.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 68.0 53.4 4.4sec 2.5sec 68.61% 72.97% 53.4(62.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.27%
  • elemental_focus_2:39.35%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.0 0.7 13.7sec 13.2sec 8.02% 23.44% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.02%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.97% 29.97% 4.2(4.2) 12.6

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.0sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.6sec 19.1sec 37.99% 33.87% 6.3(17.4) 0.6

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.15%
  • power_of_the_maelstrom_2:6.17%
  • power_of_the_maelstrom_3:25.66%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.5sec 90.5sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.15% 11.10% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.13%
  • stormkeeper_2:3.05%
  • stormkeeper_3:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 99.20% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.8 13.2sec
Lava Surge: Wasted 0.8 85.2sec
Lava Surge: During Lava Burst 7.8 34.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6600.0007.2262.2410.0009.745
Fire Elemental0.4320.0011.4800.6500.0003.934
Ascendance5.6190.00171.0255.5430.00071.025
Lava Burst0.8010.0009.8935.3770.00022.930

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Terror
earth_shock Maelstrom 50.5 5095.7 100.9 100.9 17018.0
flame_shock Maelstrom 11.3 207.5 18.3 18.3 183713.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.59 1156.65 (21.58%) 11.73 26.49 2.24%
Lava Burst Overload Maelstrom 51.70 442.50 (8.26%) 8.56 22.75 4.89%
Lightning Bolt Maelstrom 74.38 595.04 (11.10%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 71.21 424.40 (7.92%) 5.96 2.86 0.67%
Aftershock Maelstrom 61.85 1590.98 (29.69%) 25.73 0.00 0.00%
Resonance Totem Maelstrom 298.59 291.05 (5.43%) 0.97 7.55 2.53%
The Deceiver's Blood Pact Maelstrom 10.08 858.82 (16.02%) 85.16 158.25 15.56%
Resource RPS-Gain RPS-Loss
Maelstrom 17.86 17.68
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.99 10.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Charm + Terror Damage Per Second
Count 24999
Mean 1285799.26
Minimum 1043338.30
Maximum 1592355.82
Spread ( max - min ) 549017.52
Range [ ( max - min ) / 2 * 100% ] 21.35%
Standard Deviation 71223.2093
5th Percentile 1170446.65
95th Percentile 1405536.29
( 95th Percentile - 5th Percentile ) 235089.63
Mean Distribution
Standard Deviation 450.4641
95.00% Confidence Intervall ( 1284916.37 - 1286682.15 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11787
0.1 Scale Factor Error with Delta=300 43303874
0.05 Scale Factor Error with Delta=300 173215495
0.01 Scale Factor Error with Delta=300 4330387361
Priority Target DPS
Sample Data Charm + Terror Priority Target Damage Per Second
Count 24999
Mean 1285799.26
Minimum 1043338.30
Maximum 1592355.82
Spread ( max - min ) 549017.52
Range [ ( max - min ) / 2 * 100% ] 21.35%
Standard Deviation 71223.2093
5th Percentile 1170446.65
95th Percentile 1405536.29
( 95th Percentile - 5th Percentile ) 235089.63
Mean Distribution
Standard Deviation 450.4641
95.00% Confidence Intervall ( 1284916.37 - 1286682.15 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11787
0.1 Scale Factor Error with Delta=300 43303874
0.05 Scale Factor Error with Delta=300 173215495
0.01 Scale Factor Error with Delta=300 4330387361
DPS(e)
Sample Data Charm + Terror Damage Per Second (Effective)
Count 24999
Mean 1285799.26
Minimum 1043338.30
Maximum 1592355.82
Spread ( max - min ) 549017.52
Range [ ( max - min ) / 2 * 100% ] 21.35%
Damage
Sample Data Charm + Terror Damage
Count 24999
Mean 326931532.84
Minimum 259704173.15
Maximum 416757991.03
Spread ( max - min ) 157053817.88
Range [ ( max - min ) / 2 * 100% ] 24.02%
DTPS
Sample Data Charm + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.98 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.45 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 19.99 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.32 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.89 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.82 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.53 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.74 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 49.68 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLIILLLLLILLLLLILPNPPQNLQQNLLLLLLIGLLLNLPPPLNLLJLLLLIKKKLGLIIIL97LNPPPLNQAQQLNMPPLNLPPNPQOLLNQQQLLJNQQMQLLNQQQLNLLLLLILLQNQQQLNMPPPLNLQQQLLIPHPPAJLL9IQQQFLLLIILLLLILLLLIMPLPPLLIOPPPLLIIPPPLNQMQQLJNQLKKLNPQQLLNQQQLLMNPAPPLNQQQLLL9IQLLNQLNQLLL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.959 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:03.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
0:04.193 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.008 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.820 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(5)
0:06.625 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
0:07.418 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:07.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.463 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.3/125: 71% maelstrom bloodlust, ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
0:09.240 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.3/125: 89% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:10.262 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.3/125: 99% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:11.017 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:11.770 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:12.762 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:13.752 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:14.743 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:15.735 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:16.744 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:17.502 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:18.511 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:19.520 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:20.278 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:21.287 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.426 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.280 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.422 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.561 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.416 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.555 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.693 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.834 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.688 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.828 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.967 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.108 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.2/125: 63% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.964 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.9/125: 24% maelstrom bloodlust, ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.819 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.9/125: 34% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.959 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.9/125: 45% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:38.078 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:39.197 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.9/125: 81% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.315 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.9/125: 91% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:41.432 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:42.524 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.635 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.114 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:46.595 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.706 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.817 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.928 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.409 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.889 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.371 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.852 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.7/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.963 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.443 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.1/125: 38% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.922 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.113 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.593 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.073 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.1/125: 79% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.552 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.1/125: 90% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.033 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.143 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.255 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.367 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.479 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.959 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.070 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.181 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.294 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.407 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.518 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:19.608 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:20.696 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:20.696 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:22.148 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:23.239 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.689 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:26.169 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.648 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.129 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.238 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.717 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.717 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides
1:33.178 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(2)
1:34.620 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(3)
1:36.043 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.6/125: 76% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(5)
1:37.086 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 29.8/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(6)
1:38.118 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.8/125: 13% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
1:39.475 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(8)
1:40.818 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:41.803 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:42.789 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:44.102 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:45.414 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:46.727 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:47.711 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:49.023 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:50.334 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 55.1/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:51.088 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:52.399 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.512 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.1/125: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.623 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.075 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.9/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:57.527 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:58.980 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:00.069 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.9/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:01.522 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 105.9/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:02.610 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.9/125: 86% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:03.699 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:04.791 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:05.880 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.990 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.101 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.213 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.7/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.693 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.7/125: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.803 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.282 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.765 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.246 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.2/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:17.727 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.2/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.840 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:20.324 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.806 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.286 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.399 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.9/125: 90% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.879 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.9/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:26.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:28.420 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.872 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.325 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.435 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.6/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.914 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.394 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.877 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.359 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.472 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.583 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.2/125: 8% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.063 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.2/125: 15% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.545 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.027 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.508 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.619 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.2/125: 25% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.730 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.2/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.211 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.2/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.693 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.172 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.283 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.2/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.764 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.2/125: 96% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.874 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.355 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.468 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.949 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.431 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.431 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
3:03.703 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.2/125: 72% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
3:04.785 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.2/125: 83% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
3:06.208 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 116.2/125: 93% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(4)
3:07.244 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.2/125: 94% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(5)
3:08.268 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
3:09.282 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
3:10.282 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.3/125: 53% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(8)
3:11.272 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(9)
3:11.272 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(9)
3:12.574 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:13.862 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.3/125: 87% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:15.150 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.3/125: 97% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:16.117 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:17.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:18.370 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:19.658 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:20.947 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:22.258 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:23.242 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.723 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.175 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.625 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.9/125: 84% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.074 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.162 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.251 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.732 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.845 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.325 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.804 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.915 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.5/125: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.397 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.509 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.264 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.745 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:44.225 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:45.705 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:46.794 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.244 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:49.335 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:50.424 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:51.877 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.358 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.840 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.322 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.433 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.912 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.025 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.505 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.987 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.467 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.558 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.649 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.737 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.827 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.916 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.007 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.3/125: 73% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.457 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.3/125: 83% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.547 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.000 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.484 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.964 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.446 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.556 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.669 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:23.149 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.631 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:26.113 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.225 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.705 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.817 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.931 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.412 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.412 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
4:33.876 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.7/125: 45% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
4:35.319 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
4:36.744 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
4:37.787 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
4:39.159 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:40.516 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
4:41.844 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:42.812 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:44.101 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:45.068 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:46.035 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:47.003 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:48.292 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:49.276 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:50.585 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:51.569 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:52.881 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.992 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.2/125: 59% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.106 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.587 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.700 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.181 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Thurible : 1261882 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1261881.6 1261881.6 874.6 / 0.069% 273991.4 / 21.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Thurible 1261882
Earth Shock 283762 22.5% 50.5 5.77sec 1684794 1616187 Direct 50.5 1225139 3515587 1684759 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.53 50.53 0.00 0.00 1.0425 0.0000 85127799.76 85127799.76 0.00 1616186.96 1616186.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.39 79.93% 1225138.97 760779 1662133 1224754.22 1040969 1424831 49482109 49482109 0.00
crit 10.14 20.07% 3515586.87 2184956 4773647 3513075.38 0 4588351 35645691 35645691 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 128531 10.2% 11.3 27.13sec 3406531 3308185 Direct 11.3 92357 269723 222288 73.3%  
Periodic 217.7 50924 204079 165539 74.8% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 217.73 217.73 1.0298 1.3693 38560206.32 38560206.32 0.00 124467.66 3308185.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.03 26.74% 92356.98 82726 101213 91914.30 0 101213 279566 279566 0.00
crit 8.29 73.26% 269723.41 237590 290685 269786.65 258316 281665 2236681 2236681 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.8 25.16% 50924.45 34 55668 50933.88 47477 52843 2789856 2789856 0.00
crit 162.9 74.84% 204078.76 146 223832 204095.64 195807 211089 33254103 33254103 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 318189 (465552) 25.2% (36.9%) 98.6 3.02sec 1416534 1113792 Direct 98.4 0 970108 970108 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.60 98.40 0.00 0.00 1.2718 0.0000 95455754.80 95455754.80 0.00 1113792.11 1113792.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.40 100.00% 970108.10 783297 1167216 968675.42 903394 1029407 95455755 95455755 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 132887 10.5% 51.7 5.71sec 771258 0 Direct 51.6 0 773226 773226 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.69 51.56 0.00 0.00 0.0000 0.0000 39865313.77 39865313.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.56 100.00% 773226.45 624244 930206 772089.69 706957 839629 39865314 39865314 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14477 1.1% 73.4 3.84sec 59180 0 Direct 73.4 48953 99857 59180 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.38 73.38 0.00 0.00 0.0000 0.0000 4342892.58 4342892.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.64 79.91% 48953.23 47009 52285 48952.95 47459 51243 2870667 2870667 0.00
crit 14.74 20.09% 99856.69 95898 106661 99852.61 95898 106661 1472226 1472226 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 86729 (158560) 6.9% (12.6%) 74.4 3.93sec 639147 477073 Direct 74.4 253689 731459 349599 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.42 74.42 0.00 0.00 1.3397 0.0000 26017902.15 26017902.15 0.00 477073.03 477073.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.48 79.93% 253688.62 163962 601812 254929.61 205784 344811 15090493 15090493 0.00
crit 14.94 20.07% 731458.77 470900 1728404 734422.16 490450 1533900 10927409 10927409 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 71832 5.7% 71.2 5.22sec 302708 0 Direct 71.2 219666 633872 302709 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.19 71.19 0.00 0.00 0.0000 0.0000 21549141.85 21549141.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.92 79.95% 219665.92 137728 505522 220372.24 159801 316404 12502480 12502480 0.00
crit 14.27 20.05% 633871.93 395556 1451859 635849.64 415241 1308985 9046662 9046662 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 32311 2.6% 16.6 17.68sec 583919 0 Direct 16.5 487076 993635 589168 20.2%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.60 16.45 0.00 0.00 0.0000 0.0000 9693426.46 9693426.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.14 79.85% 487076.02 487076 487076 487076.02 487076 487076 6398798 6398798 0.00
crit 3.32 20.15% 993635.07 993635 993635 961479.76 0 993635 3294628 3294628 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 252815 / 168876
Fire Blast 218470 11.6% 91.3 3.24sec 479398 240438 Direct 91.3 399314 798610 479395 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.33 91.33 0.00 0.00 1.9939 0.0000 43784090.27 43784090.27 0.00 240438.49 240438.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.01 79.94% 399314.28 380721 423458 399345.74 391216 409776 29155308 29155308 0.00
crit 18.32 20.06% 798609.81 761443 846916 798681.62 771716 834705 14628782 14628782 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34346 1.8% 10.3 30.73sec 668927 477007 Direct 10.3 118131 236252 141805 20.0%  
Periodic 106.4 42437 84870 50959 20.1% 68.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.28 10.28 106.39 106.39 1.4024 1.9377 6879869.99 6879869.99 0.00 31190.47 477006.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.22 79.96% 118131.06 112806 125469 118135.21 0 124495 971497 971497 0.00
crit 2.06 20.04% 236252.34 225613 250938 211844.84 0 250938 486924 486924 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.0 79.92% 42436.69 22 47051 42440.54 40932 44650 3608138 3608138 0.00
crit 21.4 20.08% 84869.55 43 94102 84881.65 70945 91781 1813311 1813311 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182151 / 24288
Lightning Blast 182151 1.9% 37.2 7.00sec 196031 191869 Direct 37.2 163210 326456 196032 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.17 37.17 0.00 0.00 1.0217 0.0000 7286033.54 7286033.54 0.00 191869.00 191869.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.69 79.89% 163210.42 156675 174263 163210.49 158608 170605 4846497 4846497 0.00
crit 7.47 20.11% 326455.66 313351 348525 326355.62 0 348525 2439537 2439537 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Thurible
Ascendance 2.0 185.41sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 99.66sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 0.00 0.00 0.00 1.0787 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8771 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.88sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.1sec 50.1sec 27.33% 47.89% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.24% 32.24% 3.0(3.0) 8.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.9 51.0 4.5sec 2.5sec 66.69% 71.37% 51.0(58.6) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.98%
  • elemental_focus_2:37.71%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.1 0.7 13.7sec 13.2sec 8.03% 23.49% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.03%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.0sec 30.03% 30.03% 4.3(4.3) 12.6

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.7sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.6sec 19.1sec 38.06% 33.89% 6.3(17.4) 0.6

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.15%
  • power_of_the_maelstrom_2:6.16%
  • power_of_the_maelstrom_3:25.75%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.5sec 90.5sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Spear of Anguish 16.6 0.0 17.9sec 17.9sec 16.53% 16.53% 0.0(0.0) 16.5

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.13% 11.10% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.13%
  • stormkeeper_2:3.02%
  • stormkeeper_3:3.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 99.15% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.8 13.2sec
Lava Surge: Wasted 0.8 83.7sec
Lava Surge: During Lava Burst 7.8 34.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6600.0007.6232.2370.00012.381
Fire Elemental0.4090.0011.4810.5890.0003.802
Ascendance5.6960.00184.7015.6250.00084.701
Lava Burst0.7940.00010.9895.2990.00019.443

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Thurible
earth_shock Maelstrom 50.5 5098.6 100.9 100.9 16696.4
flame_shock Maelstrom 11.3 207.4 18.3 18.3 185928.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.59 1156.40 (21.57%) 11.73 26.69 2.26%
Lava Burst Overload Maelstrom 51.69 442.22 (8.25%) 8.56 22.97 4.94%
Lightning Bolt Maelstrom 74.43 595.42 (11.10%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 71.19 424.33 (7.91%) 5.96 2.84 0.66%
Aftershock Maelstrom 61.85 1591.79 (29.69%) 25.74 0.00 0.00%
Resonance Totem Maelstrom 298.59 290.99 (5.43%) 0.97 7.59 2.54%
The Deceiver's Blood Pact Maelstrom 10.11 860.93 (16.06%) 85.18 158.97 15.59%
Resource RPS-Gain RPS-Loss
Maelstrom 17.87 17.69
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.59 8.20 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Thurible Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Charm + Thurible Damage Per Second
Count 24999
Mean 1261881.58
Minimum 1030913.14
Maximum 1542751.00
Spread ( max - min ) 511837.86
Range [ ( max - min ) / 2 * 100% ] 20.28%
Standard Deviation 70556.7121
5th Percentile 1147863.70
95th Percentile 1379472.26
( 95th Percentile - 5th Percentile ) 231608.56
Mean Distribution
Standard Deviation 446.2488
95.00% Confidence Intervall ( 1261006.95 - 1262756.21 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12010
0.1 Scale Factor Error with Delta=300 42497203
0.05 Scale Factor Error with Delta=300 169988809
0.01 Scale Factor Error with Delta=300 4249720209
Priority Target DPS
Sample Data Charm + Thurible Priority Target Damage Per Second
Count 24999
Mean 1261881.58
Minimum 1030913.14
Maximum 1542751.00
Spread ( max - min ) 511837.86
Range [ ( max - min ) / 2 * 100% ] 20.28%
Standard Deviation 70556.7121
5th Percentile 1147863.70
95th Percentile 1379472.26
( 95th Percentile - 5th Percentile ) 231608.56
Mean Distribution
Standard Deviation 446.2488
95.00% Confidence Intervall ( 1261006.95 - 1262756.21 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12010
0.1 Scale Factor Error with Delta=300 42497203
0.05 Scale Factor Error with Delta=300 169988809
0.01 Scale Factor Error with Delta=300 4249720209
DPS(e)
Sample Data Charm + Thurible Damage Per Second (Effective)
Count 24999
Mean 1261881.58
Minimum 1030913.14
Maximum 1542751.00
Spread ( max - min ) 511837.86
Range [ ( max - min ) / 2 * 100% ] 20.28%
Damage
Sample Data Charm + Thurible Damage
Count 24999
Mean 320612437.69
Minimum 257160568.60
Maximum 402404480.14
Spread ( max - min ) 145243911.54
Range [ ( max - min ) / 2 * 100% ] 22.65%
DTPS
Sample Data Charm + Thurible Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Thurible Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Thurible Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Thurible Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Thurible Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Thurible Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + ThuribleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Thurible Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.96 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.46 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.02 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.88 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.80 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.51 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.75 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 49.70 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLQQQFLLLILLLLLILLLLLIILLNPPPQNQLQMQQNLQLNLLLLLIIILLLJKKIKLLMNQQQLN97QQQLNQQQQALLIMQQQLLLIIQQQLNNOQQLQNQJQQLMNNLKLLLILLNPPQQLNQQQNLQMQQNLLQNQLNLLIIQHLALJL9NNILQNLKKLLLILLFLLLLILLLLIGLLPNOPPLLNPPPLLILLLLJIKGKKLLLILLNPLPNPLNMAQQQ9LPNPPLLNQQQLLNQQQNL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.958 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides
0:03.082 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(2)
0:04.193 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(4)
0:05.007 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(4)
0:05.820 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(5)
0:06.624 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(6)
0:07.419 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
0:08.204 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(8)
0:08.204 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(8)
0:09.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(9)
0:10.260 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.3/125: 87% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:11.270 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:12.029 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:13.039 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:14.049 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:15.058 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:15.817 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
0:16.826 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
0:17.583 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
0:18.592 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
0:19.600 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:20.610 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:21.621 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:22.759 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:23.616 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:24.473 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.611 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.751 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:27.607 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:28.745 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:29.885 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.026 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.167 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.4/125: 68% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:33.004 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:34.122 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:35.239 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.6/125: 44% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.356 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.194 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.312 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:39.452 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.6/125: 67% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:40.289 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:41.128 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:42.579 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:44.029 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:45.118 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:46.231 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:47.712 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:49.163 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.6/125: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:50.615 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.6/125: 91% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:52.065 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:53.155 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:54.242 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.331 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.810 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:58.292 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
0:59.773 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.113 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.224 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 113.5/125: 91% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.333 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.444 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.555 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.035 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.514 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.627 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.738 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.219 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.700 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.1/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:15.151 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:16.603 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.1/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:17.693 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.783 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.783 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:20.235 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.1/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:21.688 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:23.139 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.591 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.1/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.682 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.134 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.584 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.037 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.517 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.517 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
1:32.612 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
1:34.053 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
1:35.103 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
1:36.139 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
1:37.504 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
1:38.852 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(8)
1:40.169 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
1:41.164 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:42.476 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.3/125: 87% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:43.461 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.3/125: 97% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:44.445 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:45.431 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:46.742 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:48.053 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:49.362 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:50.673 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:51.658 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.2/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.768 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.523 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.003 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.483 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.935 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.388 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.478 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.6/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.931 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.021 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.134 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.246 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.727 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.6/125: 72% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.839 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.6/125: 69% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.951 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.4/125: 91% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.062 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:11.513 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:12.602 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.3/125: 55% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:14.053 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:15.505 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:16.987 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.3/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:18.099 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:19.581 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.062 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.173 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:23.653 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:25.134 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:26.614 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.094 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.9/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.575 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.9/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.686 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.168 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.648 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.129 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.240 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.6/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.721 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.203 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.315 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.6/125: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.796 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.6/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.276 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.6/125: 63% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.386 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.498 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.979 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.431 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.520 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.972 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.061 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.150 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.632 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.745 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.856 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.968 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.448 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.560 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.672 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:01.672 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides
3:03.132 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(2)
3:04.216 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
3:05.285 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(4)
3:06.343 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
3:07.389 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
3:08.421 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
3:09.441 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
3:10.783 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:11.768 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:12.752 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.5/125: 17% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:14.062 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(10)
3:15.047 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(10)
3:16.031 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, rising_tides(10)
3:17.015 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:18.327 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:19.637 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:20.621 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:21.931 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.411 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.411 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.890 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.2/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.372 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.2/125: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.853 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.2/125: 91% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.331 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.442 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.924 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.404 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.886 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.366 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.455 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.542 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:39.631 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.082 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.534 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.645 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.401 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.879 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.359 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.473 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.6/125: 67% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.955 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.6/125: 78% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:51.043 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:52.495 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.946 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.397 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.485 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.7/125: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.967 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.560 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.040 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.518 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.998 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:06.110 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:07.221 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:08.333 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.421 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.512 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:11.602 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:13.053 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
4:14.503 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
4:15.955 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.067 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.547 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.025 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.137 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.617 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.729 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.209 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.319 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.5/125: 29% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.800 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.280 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.390 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.501 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 9.8/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.501 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.8/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
4:32.964 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.8/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
4:34.407 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
4:35.832 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 44.8/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
4:36.875 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
4:38.249 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:39.607 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.8/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
4:40.602 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:41.915 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:43.227 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:44.212 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.4/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:45.526 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.4/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, rising_tides(10)
4:46.495 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, rising_tides(10)
4:47.785 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:49.072 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:50.360 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:51.327 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.4/125: 72% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:52.616 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.4/125: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.729 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.209 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.689 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.172 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.285 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Thurible"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=spectral_thurible,id=147018,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Tome : 1279455 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1279455.2 1279455.2 885.7 / 0.069% 277759.1 / 21.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.2 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Tome 1279455
Earth Shock 294557 23.0% 50.2 5.79sec 1760214 1678607 Direct 50.2 1254888 3590795 1760213 21.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.20 50.20 0.00 0.00 1.0486 0.0000 88366911.26 88366911.26 0.00 1678607.06 1678607.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.34 78.37% 1254887.86 779588 1694776 1254441.36 1077763 1479812 49369561 49369561 0.00
crit 10.86 21.63% 3590794.86 2238977 4867398 3588920.28 2513063 4685932 38997350 38997350 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 131527 10.3% 11.3 27.11sec 3478394 3374891 Direct 11.3 94566 275738 229125 74.3%  
Periodic 216.5 52133 208490 170254 75.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.34 11.34 216.50 216.50 1.0307 1.3772 39459227.60 39459227.60 0.00 127342.88 3374891.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.92 25.73% 94565.63 84772 103201 93976.37 0 103201 276018 276018 0.00
crit 8.43 74.27% 275738.02 243464 296394 275797.04 261414 287406 2323174 2323174 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.9 24.46% 52132.58 347 56762 52142.22 49520 54181 2760391 2760391 0.00
crit 163.6 75.54% 208489.66 149 228227 208510.31 199830 215422 34099645 34099645 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13372 1.0% 5.0 63.20sec 802267 0 Periodic 47.0 70570 144124 85346 20.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 47.00 47.00 0.0000 1.2766 4011336.15 4011336.15 0.00 66855.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.91% 70570.44 9957 76542 70568.56 66084 76542 2650462 2650462 0.00
crit 9.4 20.09% 144124.47 20312 156146 144070.98 0 156146 1360875 1360875 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 325374 (476114) 25.4% (37.2%) 98.1 3.02sec 1455661 1139439 Direct 97.9 0 996926 996926 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.12 97.91 0.00 0.00 1.2775 0.0000 97611621.52 97611621.52 0.00 1139439.43 1139439.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 97.91 100.00% 996926.46 802663 1265454 995306.44 929047 1068848 97611622 97611622 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 135826 10.6% 51.4 5.71sec 792371 0 Direct 51.3 0 794490 794490 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.42 51.29 0.00 0.00 0.0000 0.0000 40747598.57 40747598.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.29 100.00% 794490.50 639677 1008496 793203.54 724779 859110 40747599 40747599 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14914 1.2% 73.1 3.82sec 61236 0 Direct 73.1 50065 102126 61237 21.5%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.06 73.06 0.00 0.00 0.0000 0.0000 4474070.27 4474070.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.39 78.54% 50065.23 48171 53312 50065.18 48609 51928 2873011 2873011 0.00
crit 15.68 21.46% 102125.61 98268 108756 102125.17 98268 108756 1601059 1601059 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 89598 (163827) 7.0% (12.8%) 73.8 4.01sec 665984 493029 Direct 73.8 262071 732360 364231 21.7%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.80 73.80 0.00 0.00 1.3508 0.0000 26879196.22 26879196.22 0.00 493029.30 493029.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.76 78.28% 262071.19 168016 613631 263398.02 213982 355782 15137953 15137953 0.00
crit 16.03 21.72% 732359.74 482542 1762347 735173.18 504510 1347439 11741243 11741243 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 74229 5.8% 70.8 5.29sec 314739 0 Direct 70.8 226794 633364 314753 21.6%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.75 70.75 0.00 0.00 0.0000 0.0000 22268429.68 22268429.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.44 78.36% 226793.66 141134 515450 227519.95 163461 343560 12574131 12574131 0.00
crit 15.31 21.64% 633364.04 405335 1480372 635386.98 425452 1215340 9694299 9694299 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 261248 / 175312
Fire Blast 225802 11.8% 91.4 3.24sec 497187 248156 Direct 91.4 408264 816395 497195 21.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.44 91.44 0.00 0.00 2.0035 0.0000 45461222.02 45461222.02 0.00 248156.19 248156.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.52 78.21% 408264.02 390134 431774 408293.69 400284 419836 29197105 29197105 0.00
crit 19.92 21.79% 816395.46 780269 863549 816467.98 789139 847702 16264117 16264117 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 35446 1.9% 10.4 30.58sec 689029 486853 Direct 10.4 120775 241422 146585 21.4%  
Periodic 106.3 43418 86829 52810 21.6% 69.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.35 10.35 106.34 106.34 1.4153 1.9469 7133858.87 7133858.87 0.00 32179.43 486853.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.14 78.60% 120775.05 115595 127933 120784.40 116544 126577 982893 982893 0.00
crit 2.22 21.40% 241422.20 231191 255866 221910.55 0 255866 534827 534827 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.3 78.36% 43418.05 22 47975 43420.22 41970 45256 3618257 3618257 0.00
crit 23.0 21.64% 86829.34 44 95950 86836.22 70398 94348 1997882 1997882 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 185591 / 24747
Lightning Blast 185591 1.9% 37.0 7.03sec 200639 193652 Direct 37.0 166900 333847 200640 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0361 0.0000 7423656.41 7423656.41 0.00 193652.18 193652.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.52 79.79% 166900.17 160549 177685 166899.84 162131 174268 4927343 4927343 0.00
crit 7.48 20.21% 333847.24 321098 355370 333745.37 0 355370 2496314 2496314 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Tome
Ascendance 2.0 186.27sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 98.91sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 1.1041 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.58sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8640 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.75sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.2sec 50.2sec 27.15% 47.69% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.2 51.8 4.5sec 2.5sec 67.65% 72.29% 51.8(59.9) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.06%
  • elemental_focus_2:38.59%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.0 0.0 63.2sec 63.2sec 19.84% 19.84% 0.0(0.0) 4.7

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.9 0.7 13.8sec 13.3sec 8.02% 23.38% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.02%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.94% 29.94% 4.3(4.3) 12.6

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.8sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.7sec 19.1sec 37.91% 34.08% 6.3(17.4) 0.6

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.21%
  • power_of_the_maelstrom_2:6.20%
  • power_of_the_maelstrom_3:25.50%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 98.0sec 98.0sec 21.63% 21.63% 33.0(33.0) 3.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.32%
  • rising_tides_2:1.29%
  • rising_tides_3:1.26%
  • rising_tides_4:1.22%
  • rising_tides_5:1.18%
  • rising_tides_6:1.14%
  • rising_tides_7:1.10%
  • rising_tides_8:1.07%
  • rising_tides_9:1.03%
  • rising_tides_10:11.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 10.21% 11.20% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.18%
  • stormkeeper_2:3.05%
  • stormkeeper_3:3.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 98.90% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.7 13.3sec
Lava Surge: Wasted 0.8 84.3sec
Lava Surge: During Lava Burst 7.8 34.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6570.0018.7132.1580.00010.572
Fire Elemental0.4260.0011.4800.6130.0003.887
Ascendance6.2480.00166.8256.1860.00066.825
Lava Burst0.8060.0009.6275.4330.00022.003

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Tome
earth_shock Maelstrom 50.2 5066.7 100.9 100.9 17440.7
flame_shock Maelstrom 11.3 207.9 18.3 18.3 189809.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.13 1150.98 (21.59%) 11.73 26.58 2.26%
Lava Burst Overload Maelstrom 51.43 439.88 (8.25%) 8.55 22.97 4.96%
Lightning Bolt Maelstrom 73.79 590.32 (11.07%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 70.74 421.65 (7.91%) 5.96 2.80 0.66%
Aftershock Maelstrom 61.55 1582.38 (29.68%) 25.71 0.00 0.00%
Resonance Totem Maelstrom 298.59 290.97 (5.46%) 0.97 7.62 2.55%
The Deceiver's Blood Pact Maelstrom 10.03 854.50 (16.03%) 85.19 158.24 15.63%
Resource RPS-Gain RPS-Loss
Maelstrom 17.77 17.58
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.04 9.10 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Charm + Tome Damage Per Second
Count 24999
Mean 1279455.23
Minimum 1038336.53
Maximum 1573243.62
Spread ( max - min ) 534907.08
Range [ ( max - min ) / 2 * 100% ] 20.90%
Standard Deviation 71453.1066
5th Percentile 1165905.97
95th Percentile 1400568.72
( 95th Percentile - 5th Percentile ) 234662.74
Mean Distribution
Standard Deviation 451.9182
95.00% Confidence Intervall ( 1278569.49 - 1280340.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11981
0.1 Scale Factor Error with Delta=300 43583881
0.05 Scale Factor Error with Delta=300 174335524
0.01 Scale Factor Error with Delta=300 4358388094
Priority Target DPS
Sample Data Charm + Tome Priority Target Damage Per Second
Count 24999
Mean 1279455.23
Minimum 1038336.53
Maximum 1573243.62
Spread ( max - min ) 534907.08
Range [ ( max - min ) / 2 * 100% ] 20.90%
Standard Deviation 71453.1066
5th Percentile 1165905.97
95th Percentile 1400568.72
( 95th Percentile - 5th Percentile ) 234662.74
Mean Distribution
Standard Deviation 451.9182
95.00% Confidence Intervall ( 1278569.49 - 1280340.98 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11981
0.1 Scale Factor Error with Delta=300 43583881
0.05 Scale Factor Error with Delta=300 174335524
0.01 Scale Factor Error with Delta=300 4358388094
DPS(e)
Sample Data Charm + Tome Damage Per Second (Effective)
Count 24999
Mean 1279455.23
Minimum 1038336.53
Maximum 1573243.62
Spread ( max - min ) 534907.08
Range [ ( max - min ) / 2 * 100% ] 20.90%
Damage
Sample Data Charm + Tome Damage
Count 24999
Mean 323818391.27
Minimum 257362908.81
Maximum 400906060.85
Spread ( max - min ) 143543152.04
Range [ ( max - min ) / 2 * 100% ] 22.16%
DTPS
Sample Data Charm + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.97 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 19.92 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.32 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.42 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.81 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.28 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.70 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 49.15 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQLQQFLLLLILLLLLILLLLALILLLLLILLLLILLLLLIGLLPNLLLLLILLJKKKILLL97LGLILLNQAQQLLNQLNPLLMPNLLALLLILLLLILLLL8LIJKKKLLLIMPPLNNPPAPLNPPPNLQLMNQLPPNPQ9LNQQQLLHLNPJKKLILQFLALLILLLLIILLLLMNQQAQQLNPPNPLPNPOPLNIQQLLMNQJQQLNLLLLKLILLL9NPPMLPANQQQLNQQQLNNQLQALNQQM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides
0:03.062 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
0:04.150 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:04.950 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:05.748 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
0:06.538 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
0:07.319 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.103 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.103 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:09.147 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom bloodlust, ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:09.915 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.3/125: 82% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:10.935 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:11.944 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.703 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:13.714 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:14.473 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:15.483 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:16.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.229 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.982 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.974 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.8/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.8/125: 82% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:21.731 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.731 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.871 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.727 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.866 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.004 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.144 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.283 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.422 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.278 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.417 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.557 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.699 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.1/125: 83% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.838 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.1/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.692 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:36.832 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:37.973 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.2/125: 50% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.112 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.2/125: 68% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.253 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.2/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.392 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.505 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:43.616 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.095 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.547 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.000 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.541 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.629 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.108 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.588 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.069 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.180 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.661 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.141 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.253 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.367 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.1/125: 72% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.478 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 111.1/125: 89% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.590 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.703 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.184 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.666 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.146 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.258 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.258 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:12.740 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:13.851 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:15.331 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:16.443 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:17.924 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:19.036 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:20.147 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:21.598 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:21.598 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:23.049 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:24.498 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:25.587 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:27.067 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:28.179 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:29.658 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:30.747 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:31.837 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.4/125: 20% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.290 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:34.741 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:35.831 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:36.942 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:38.422 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:39.534 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:40.644 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:42.124 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:42.124 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power, rising_tides
1:43.586 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power, rising_tides(2)
1:45.029 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power, rising_tides(3)
1:46.453 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(5)
1:47.496 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
1:48.868 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
1:50.224 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
1:51.550 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:52.839 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:53.805 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:55.093 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:56.381 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:57.671 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.9/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:58.983 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 107.9/125: 86% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:59.738 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.9/125: 86% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
2:01.049 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.9/125: 98% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
2:02.018 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
2:02.987 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:04.077 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.2/125: 43% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:05.167 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:06.257 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.2/125: 67% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:07.345 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.2/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:08.797 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.2/125: 88% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:09.886 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:10.977 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.088 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:13.569 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:15.050 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:16.531 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.643 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.755 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.237 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.8/125: 33% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.718 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 56.8/125: 45% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.718 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.8/125: 45% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.199 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.679 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.8/125: 78% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.791 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.272 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.751 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.9/125: 50% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.232 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.346 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.828 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.308 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:35.420 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:36.532 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:37.642 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.121 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.602 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.085 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.565 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.676 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.157 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.607 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.696 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.148 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.237 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.689 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.170 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.652 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.765 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.245 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.356 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.838 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.948 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.429 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.541 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.653 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.767 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.247 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.469 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.581 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.581 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.062 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.062 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides
3:14.523 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.6/125: 90% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
3:15.965 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
3:17.035 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(4)
3:18.442 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
3:19.816 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
3:20.835 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
3:22.175 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:23.142 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:24.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:25.075 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:26.364 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:27.653 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:28.966 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:29.951 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:30.936 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:32.245 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:33.555 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.555 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.036 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.517 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.996 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.3/125: 83% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.108 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.589 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.069 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.2/125: 58% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:43.159 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:44.610 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.062 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:47.513 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:48.603 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.1/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:50.083 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 42.1/125: 34% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:50.838 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:52.318 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:53.769 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.1/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:54.860 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:55.952 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:57.404 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:58.856 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.449 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.561 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.674 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.152 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.265 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.377 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.489 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.969 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.560 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.4/125: 40% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.040 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.521 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.000 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.4/125: 72% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.110 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.4/125: 85% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.590 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.4/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.702 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.181 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.293 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.773 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.884 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.1/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.996 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.476 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.6/125: 34% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.956 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.067 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.547 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.029 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:34.029 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:35.119 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.5/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:36.570 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.5/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:38.022 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.472 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:40.923 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:42.034 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.515 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.995 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.477 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.959 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:49.071 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:50.181 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:51.661 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:52.772 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:54.253 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:54.253 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, rising_tides
4:55.715 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, rising_tides(2)
4:56.798 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, rising_tides(3)
4:58.225 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(4)
4:59.632 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(6)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 63945 61714 51450 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 63945 61714 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=51450
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Sentinel + Terror : 1280181 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1280181.4 1280181.4 830.7 / 0.065% 261897.4 / 20.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sentinel + Terror 1280181
Earth Shock 276808 21.6% 50.4 5.79sec 1648899 1542181 Direct 50.4 1146935 3292730 1648878 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.36 50.36 0.00 0.00 1.0692 0.0000 83041825.34 83041825.34 0.00 1542181.09 1542181.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.58 76.61% 1146935.25 706341 1550899 1146526.30 946852 1330901 44251108 44251108 0.00
crit 11.78 23.39% 3292729.59 2028612 4454181 3290682.25 2292499 4200013 38790717 38790717 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 115602 9.0% 11.3 27.13sec 3062611 2936386 Direct 11.3 85851 250989 207200 73.5%  
Periodic 211.8 47324 188813 152645 74.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 211.83 211.83 1.0430 1.4075 34681654.43 34681654.43 0.00 111891.83 2936385.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.00 26.51% 85851.14 76807 94440 85490.94 0 92526 257765 257765 0.00
crit 8.32 73.49% 250988.89 220589 271232 251053.19 238730 262625 2088667 2088667 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.1 25.56% 47323.69 2204 51943 47331.36 44329 49371 2562483 2562483 0.00
crit 157.7 74.44% 188812.55 283 208852 188834.29 179647 195458 29772739 29772739 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 289903 (441528) 22.6% (34.5%) 95.3 3.09sec 1389581 1054588 Direct 95.1 0 914308 914308 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.32 95.12 0.00 0.00 1.3177 0.0000 86970318.39 86970318.39 0.00 1054588.27 1054588.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.12 100.00% 914308.37 727248 1118612 912802.99 845536 979164 86970318 86970318 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 138233 10.8% 57.1 5.13sec 726801 0 Direct 56.9 0 728729 728729 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.06 56.91 0.00 0.00 0.0000 0.0000 41469524.79 41469524.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 56.91 100.00% 728729.05 579576 891471 727543.78 655078 786388 41469525 41469525 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13392 1.0% 71.0 3.97sec 56561 0 Direct 71.0 45527 92887 56560 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.03 71.03 0.00 0.00 0.0000 0.0000 4017497.77 4017497.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.48 76.70% 45527.39 43645 48786 45527.79 44005 47387 2480382 2480382 0.00
crit 16.55 23.30% 92887.00 89037 99524 92888.39 89037 98515 1537115 1537115 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 82324 (156052) 6.4% (12.2%) 71.9 4.12sec 651226 477387 Direct 71.9 238777 687160 343533 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.89 71.89 0.00 0.00 1.3642 0.0000 24696819.69 24696819.69 0.00 477386.90 477386.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.09 76.63% 238777.24 152230 561537 239965.97 191892 355586 13154216 13154216 0.00
crit 16.80 23.37% 687160.48 437205 1612735 690408.29 463598 1436409 11542603 11542603 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73728 5.8% 74.5 5.12sec 296769 0 Direct 74.5 206266 593971 296768 23.3%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.53 74.53 0.00 0.00 0.0000 0.0000 22117649.43 22117649.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.13 76.66% 206266.14 127873 471691 206985.44 147011 300157 11784447 11784447 0.00
crit 17.40 23.34% 593971.03 367252 1354697 596132.74 390072 1224323 10333203 10333203 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (64663) 0.0% (5.1%) 3.0 120.43sec 6465928 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 323296.38 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 20402 1.6% 36.3 7.34sec 168499 0 Direct 36.3 135409 276235 168497 23.5%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.32 36.32 0.00 0.00 0.0000 0.0000 6120385.96 6120385.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.79 76.50% 135409.19 135409 135409 135409.19 135409 135409 3762750 3762750 0.00
crit 8.53 23.50% 276234.76 276235 276235 276179.51 0 276235 2357636 2357636 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 44261 3.5% 92.0 2.86sec 144320 0 Direct 92.0 116064 236771 144319 23.4%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.00 92.00 0.00 0.00 0.0000 0.0000 13277396.93 13277396.93 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.46 76.59% 116064.33 116064 116064 116064.33 116064 116064 8178419 8178419 0.00
crit 21.54 23.41% 236771.23 236771 236771 236771.23 236771 236771 5098978 5098978 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
Terror From Below 49472 3.9% 9.7 28.95sec 1533349 0 Direct 9.7 1233906 2517168 1533481 23.3%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.68 9.68 0.00 0.00 0.0000 0.0000 14842189.35 14842189.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.42 76.67% 1233905.72 1233906 1233906 1233905.72 1233906 1233906 9156687 9156687 0.00
crit 2.26 23.33% 2517167.67 2517168 2517168 2276516.81 0 2517168 5685502 5685502 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 233527 / 152931
Fire Blast 201403 10.3% 86.3 3.39sec 458505 222019 Direct 86.3 371710 743415 458504 23.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.30 86.30 0.00 0.00 2.0652 0.0000 39570902.16 39570902.16 0.00 222019.07 222019.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.15 76.65% 371710.21 353479 395119 371734.91 363506 382646 24589373 24589373 0.00
crit 20.15 23.35% 743414.81 706958 790238 743467.88 717635 774391 14981529 14981529 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32124 1.6% 10.1 30.97sec 623256 434457 Direct 10.1 109954 219950 135682 23.4%  
Periodic 101.3 39498 78986 48708 23.3% 67.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 10.12 101.34 101.34 1.4346 1.9998 6309617.57 6309617.57 0.00 29052.88 434456.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.76 76.61% 109953.77 104735 117072 109959.15 104735 116123 852719 852719 0.00
crit 2.37 23.39% 219950.16 209469 234145 205353.29 0 234145 520936 520936 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.7 76.67% 39497.81 13597 43902 39499.15 38112 41511 3068970 3068970 0.00
crit 23.6 23.33% 78985.50 27193 87804 78986.31 68779 85125 1866993 1866993 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 173421 / 23124
Lightning Blast 173421 1.8% 37.0 7.03sec 187482 179431 Direct 37.0 151823 303690 187476 23.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6936820.30 6936820.30 0.00 179431.46 179431.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.31 76.52% 151822.96 145465 162600 151824.46 146986 159191 4298552 4298552 0.00
crit 8.69 23.48% 303689.59 290929 325201 303697.86 290929 325201 2638268 2638268 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Sentinel + Terror
Ascendance 2.0 186.31sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 100.39sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.68sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.89sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.7sec 49.7sec 27.40% 46.56% 0.0(0.0) 5.7

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.22% 32.22% 3.0(3.0) 8.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.5 50.2 4.5sec 2.5sec 68.73% 73.37% 50.2(58.5) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.12%
  • elemental_focus_2:39.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.4 0.7 14.1sec 13.6sec 7.98% 23.39% 0.7(0.7) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.99% 29.99% 4.3(4.3) 12.6

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.9sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.9sec 19.7sec 37.76% 34.45% 5.9(16.2) 0.7

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.24%
  • power_of_the_maelstrom_2:6.20%
  • power_of_the_maelstrom_3:25.31%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.45% 11.51% 0.0(0.0) 0.2

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.25%
  • stormkeeper_2:3.11%
  • stormkeeper_3:4.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.67% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.1 13.6sec
Lava Surge: Wasted 0.7 83.3sec
Lava Surge: During Lava Burst 7.5 35.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6820.0017.6092.2870.00010.282
Fire Elemental0.4310.0011.4790.6300.0004.051
Ascendance6.4090.00170.3436.3400.00070.343
Lava Burst0.8150.00012.4275.4540.00023.904

Resources

Resource Usage Type Count Total Average RPE APR
Sentinel + Terror
earth_shock Maelstrom 50.4 5102.4 101.3 101.3 16275.2
flame_shock Maelstrom 11.3 207.5 18.3 18.3 167152.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.32 1117.44 (20.82%) 11.72 26.43 2.31%
Lava Burst Overload Maelstrom 57.06 487.30 (9.08%) 8.54 26.19 5.10%
Lightning Bolt Maelstrom 71.89 575.10 (10.72%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 74.53 443.99 (8.27%) 5.96 3.17 0.71%
Aftershock Maelstrom 61.68 1592.95 (29.68%) 25.82 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.48 (5.41%) 0.97 8.10 2.71%
The Deceiver's Blood Pact Maelstrom 10.07 859.69 (16.02%) 85.34 161.15 15.79%
Resource RPS-Gain RPS-Loss
Maelstrom 17.89 17.70
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.68 9.10 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Sentinel + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Sentinel + Terror Damage Per Second
Count 24999
Mean 1280181.39
Minimum 1050499.89
Maximum 1578506.36
Spread ( max - min ) 528006.47
Range [ ( max - min ) / 2 * 100% ] 20.62%
Standard Deviation 67011.5664
5th Percentile 1173342.13
95th Percentile 1393478.15
( 95th Percentile - 5th Percentile ) 220136.03
Mean Distribution
Standard Deviation 423.8268
95.00% Confidence Intervall ( 1279350.71 - 1281012.08 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10526
0.1 Scale Factor Error with Delta=300 38333918
0.05 Scale Factor Error with Delta=300 153335672
0.01 Scale Factor Error with Delta=300 3833391791
Priority Target DPS
Sample Data Sentinel + Terror Priority Target Damage Per Second
Count 24999
Mean 1280181.39
Minimum 1050499.89
Maximum 1578506.36
Spread ( max - min ) 528006.47
Range [ ( max - min ) / 2 * 100% ] 20.62%
Standard Deviation 67011.5664
5th Percentile 1173342.13
95th Percentile 1393478.15
( 95th Percentile - 5th Percentile ) 220136.03
Mean Distribution
Standard Deviation 423.8268
95.00% Confidence Intervall ( 1279350.71 - 1281012.08 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10526
0.1 Scale Factor Error with Delta=300 38333918
0.05 Scale Factor Error with Delta=300 153335672
0.01 Scale Factor Error with Delta=300 3833391791
DPS(e)
Sample Data Sentinel + Terror Damage Per Second (Effective)
Count 24999
Mean 1280181.39
Minimum 1050499.89
Maximum 1578506.36
Spread ( max - min ) 528006.47
Range [ ( max - min ) / 2 * 100% ] 20.62%
Damage
Sample Data Sentinel + Terror Damage
Count 24999
Mean 331235262.09
Minimum 270826261.46
Maximum 416278419.03
Spread ( max - min ) 145452157.57
Range [ ( max - min ) / 2 * 100% ] 21.96%
DTPS
Sample Data Sentinel + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sentinel + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sentinel + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sentinel + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sentinel + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sentinel + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Sentinel + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Sentinel + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.93 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.08 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.29 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.38 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.62 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.78 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.07 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.26 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 47.60 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLKKKLFIILLLLLILLLLIILLLLLILLLLILLLLLILGLLNPLNPPLNQQJQLNILLLLLG97ILLNNQQQLNQQQQLNMQQQLLNPPPLNOQQQNLAQJQQNLMQQQQLNQQQNLQQQNNLPPNPLLMNPPPLNIQQQLNQHQQJLNLQQL9NQQLFLLLIILLLLLILLMPNNPPLNOQQQLLNQLQLNAMLLJQQQNLPPPNLLLLIILLLLILLLLGNPPPL9NIIQQLNQQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.082 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.200 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.039 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.877 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.715 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.553 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.410 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.3/125: 81% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.263 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.263 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.118 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.975 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.114 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.254 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.394 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.534 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.671 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.526 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.667 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.947 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.088 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.945 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.801 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.918 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.034 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.872 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.987 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.104 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.941 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.058 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.898 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.014 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.132 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.1/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.986 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.2/125: 35% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.126 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.2/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.266 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.2/125: 57% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.406 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.2/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.545 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.2/125: 92% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.663 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.501 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.952 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.042 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.492 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.944 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.056 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.648 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.761 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.241 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.722 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.1/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.202 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.312 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.792 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.272 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.383 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.495 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.947 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.7/125: 71% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.038 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.127 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.579 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:09.032 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.145 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.626 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.105 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:14.195 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:15.286 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:15.286 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:16.375 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:17.827 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:19.279 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:20.391 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:21.502 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.2/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.984 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.464 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.915 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.368 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.458 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.6/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.911 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.393 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.875 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.838 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.6/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:36.928 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:38.018 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.3/125: 15% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:39.469 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:40.919 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:42.370 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:43.482 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.962 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.3/125: 73% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:46.073 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.554 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.034 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.6/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.512 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.6/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.991 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.6/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.102 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.855 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.335 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.815 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.3/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.296 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.3/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.408 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.8/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.889 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.889 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.338 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.428 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.516 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.607 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.8/125: 65% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.697 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.150 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.262 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.8/125: 21% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.374 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.8/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.855 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.337 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.817 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.296 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.8/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:17.409 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.1/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:18.889 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:20.370 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.1/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:21.852 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:22.963 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.7/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.443 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.923 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.403 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.882 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.992 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.104 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.558 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.010 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.461 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.550 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.6/125: 25% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.001 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.112 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.593 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.6/125: 71% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.704 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.815 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.295 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.776 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.256 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.737 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.1/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.848 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.961 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.441 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.921 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.400 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.881 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.991 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.473 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.585 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.066 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.544 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.9/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.133 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.244 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.353 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.463 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.574 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.054 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.166 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.9/125: 67% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.277 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.8/125: 21% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.390 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.8/125: 33% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.869 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.981 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.981 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.461 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.8/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:20.941 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.8/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:22.393 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.484 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.025 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.476 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.564 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.044 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.156 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.267 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.748 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.230 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.342 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.823 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.936 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.048 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.529 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.009 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.489 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.7/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.600 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.354 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:47.806 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.258 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:50.709 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:52.160 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.4/125: 73% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.250 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.4/125: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:54.341 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.793 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.882 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.333 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.813 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.903 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 27.4/125: 22% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.903 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.4/125: 22% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.994 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.4/125: 12% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.084 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.4/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.534 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 40.4/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.739 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.826 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.937 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.4/125: 53% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.049 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.159 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.640 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.123 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.603 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.083 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.7/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.194 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.673 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.2/125: 43% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.153 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.2/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.634 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.2/125: 79% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.115 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.2/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.226 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.338 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.819 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.272 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:29.723 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.814 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.902 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.863 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.343 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.824 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.2/125: 95% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.937 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.2/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:40.050 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:41.532 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.013 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.492 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.7/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.973 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 104.7/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:47.064 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.7/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:48.153 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.243 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:50.332 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.785 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.718 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.829 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.309 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.790 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Sentinel + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Sentinel + Tome : 1281441 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1281440.7 1281440.7 843.4 / 0.066% 265353.7 / 20.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sentinel + Tome 1281441
Earth Shock 284470 22.2% 50.4 5.76sec 1692619 1583163 Direct 50.4 1206477 3454785 1692679 21.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.42 50.42 0.00 0.00 1.0692 0.0000 85340392.51 85340392.51 0.00 1583162.83 1583162.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.52 78.38% 1206476.73 744671 1626190 1206092.27 1011493 1412650 47677292 47677292 0.00
crit 10.90 21.62% 3454785.09 2138696 4670418 3453247.84 2412770 4435714 37663101 37663101 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120601 9.4% 11.3 27.10sec 3197317 3065927 Direct 11.3 90330 264051 216708 72.7%  
Periodic 211.8 49803 198931 159217 73.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 211.84 211.84 1.0429 1.4074 36181007.14 36181007.14 0.00 116734.39 3065927.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.08 27.25% 90329.68 80975 99025 89974.16 0 99025 278585 278585 0.00
crit 8.23 72.75% 264051.02 232560 284399 264111.17 252808 275593 2173664 2173664 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.4 26.63% 49802.73 319 54465 49810.90 46926 51862 2809581 2809581 0.00
crit 155.4 73.37% 198930.69 267 218991 198954.83 190218 207161 30919177 30919177 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13363 1.0% 5.0 60.51sec 801722 0 Periodic 47.0 70598 143943 85290 20.0% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 47.00 47.00 0.0000 1.2766 4008609.07 4008609.07 0.00 66810.15 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.97% 70598.14 9957 76542 70599.46 65566 76542 2653461 2653461 0.00
crit 9.4 20.03% 143942.69 20312 156146 143940.58 0 156146 1355148 1355148 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 301917 (459761) 23.6% (35.9%) 95.3 3.11sec 1446812 1098238 Direct 95.1 0 952124 952124 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.33 95.13 0.00 0.00 1.3174 0.0000 90574112.97 90574112.97 0.00 1098238.30 1098238.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.13 100.00% 952123.83 766713 1214242 950520.59 881714 1025223 90574113 90574113 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 143988 11.2% 57.1 5.15sec 756840 0 Direct 56.9 0 758877 758877 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.07 56.92 0.00 0.00 0.0000 0.0000 43195957.02 43195957.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 56.92 100.00% 758877.19 611027 967683 757598.28 696235 824117 43195957 43195957 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13855 1.1% 70.9 3.94sec 58641 0 Direct 70.9 47898 97711 58642 21.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.88 70.88 0.00 0.00 0.0000 0.0000 4156580.36 4156580.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.60 78.43% 47897.93 46014 51154 47897.80 46367 49794 2662917 2662917 0.00
crit 15.29 21.57% 97710.57 93868 104355 97712.73 93868 103035 1493664 1493664 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 84044 (159352) 6.6% (12.4%) 71.9 4.11sec 665063 487451 Direct 71.9 252274 707528 350765 21.6%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.88 71.88 0.00 0.00 1.3644 0.0000 25213041.61 25213041.61 0.00 487451.29 487451.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.33 78.37% 252274.41 160491 588798 253580.37 200016 364852 14210546 14210546 0.00
crit 15.55 21.63% 707527.65 460930 1691027 710528.83 474136 1280069 11002496 11002496 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 75307 5.9% 74.6 5.13sec 302973 0 Direct 74.6 218110 609354 302977 21.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.57 74.57 0.00 0.00 0.0000 0.0000 22591794.04 22591794.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.39 78.31% 218110.03 134812 494590 218883.27 160350 324001 12735892 12735892 0.00
crit 16.17 21.69% 609353.63 387181 1420463 611284.77 395501 1208353 9855902 9855902 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (62866) 0.0% (4.9%) 3.0 120.40sec 6286240 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 314311.99 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19825 1.5% 36.3 7.38sec 163850 0 Direct 36.3 135409 276235 163849 20.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.30 36.30 0.00 0.00 0.0000 0.0000 5947247.87 5947247.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.97 79.80% 135409.19 135409 135409 135409.19 135409 135409 3922333 3922333 0.00
crit 7.33 20.20% 276234.76 276235 276235 276135.31 0 276235 2024915 2024915 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 43041 3.4% 92.0 2.86sec 140342 0 Direct 92.0 116064 236771 140341 20.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.00 92.00 0.00 0.00 0.0000 0.0000 12911471.39 12911471.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.50 79.89% 116064.33 116064 116064 116064.33 116064 116064 8530271 8530271 0.00
crit 18.50 20.11% 236771.23 236771 236771 236771.23 236771 236771 4381201 4381201 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - primal_fire_elemental 242393 / 157342
Fire Blast 209065 10.6% 85.6 3.42sec 475699 230475 Direct 85.6 390994 781925 475694 21.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.59 85.59 0.00 0.00 2.0640 0.0000 40714739.29 40714739.29 0.00 230474.70 230474.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.04 78.33% 390994.27 372661 414301 391017.26 382473 401986 26213845 26213845 0.00
crit 18.55 21.67% 781924.86 745322 828602 781986.14 754931 820193 14500894 14500894 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 33328 1.7% 10.0 31.25sec 646402 450659 Direct 10.0 115663 231239 140228 21.3%  
Periodic 100.6 41548 83118 50498 21.5% 67.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.04 10.04 100.62 100.62 1.4344 1.9990 6488586.51 6488586.51 0.00 30105.54 450658.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.90 78.74% 115663.36 110418 122756 115672.71 111367 122756 914243 914243 0.00
crit 2.13 21.26% 231238.89 220836 245512 210025.45 0 245512 493384 493384 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.0 78.47% 41548.24 14302 46033 41549.46 40126 43257 3280411 3280411 0.00
crit 21.7 21.53% 83118.48 28605 92067 83113.21 70544 90902 1800549 1800549 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177640 / 23687
Lightning Blast 177640 1.8% 37.0 7.03sec 192043 183802 Direct 37.0 159736 319552 192043 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7105588.82 7105588.82 0.00 183801.67 183801.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.52 79.78% 159735.57 153358 170494 159734.86 155204 166686 4715461 4715461 0.00
crit 7.48 20.22% 319552.16 306717 340988 319499.80 0 340988 2390127 2390127 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Sentinel + Tome
Ascendance 2.0 186.39sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 101.26sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.90 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.67sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.74sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.8sec 49.8sec 27.35% 46.48% 0.0(0.0) 5.7

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.23% 32.23% 3.0(3.0) 8.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.0 49.0 4.5sec 2.6sec 67.69% 72.56% 49.0(56.8) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.94%
  • elemental_focus_2:38.75%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.0 0.0 60.5sec 60.5sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 8.01% 23.45% 0.7(0.7) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.01%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 30.03% 30.03% 4.3(4.3) 12.6

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.6sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.9sec 19.7sec 37.73% 34.49% 5.9(16.2) 0.7

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.24%
  • power_of_the_maelstrom_2:6.24%
  • power_of_the_maelstrom_3:25.25%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.47% 11.51% 0.0(0.0) 0.2

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.25%
  • stormkeeper_2:3.11%
  • stormkeeper_3:4.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.49% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 84.0sec
Lava Surge: During Lava Burst 7.5 35.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6780.0017.6092.2680.00010.021
Fire Elemental0.4190.0011.4810.5960.0003.866
Ascendance6.3240.00166.4226.2590.00066.422
Lava Burst0.8130.00011.1225.4460.00022.818

Resources

Resource Usage Type Count Total Average RPE APR
Sentinel + Tome
earth_shock Maelstrom 50.4 5107.6 101.3 101.3 16708.6
flame_shock Maelstrom 11.3 207.3 18.3 18.3 174519.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.33 1117.36 (20.80%) 11.72 26.61 2.33%
Lava Burst Overload Maelstrom 57.07 487.42 (9.07%) 8.54 26.25 5.11%
Lightning Bolt Maelstrom 71.88 575.06 (10.70%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 74.57 444.27 (8.27%) 5.96 3.12 0.70%
Aftershock Maelstrom 61.73 1594.47 (29.68%) 25.83 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.47 (5.41%) 0.97 8.10 2.71%
The Deceiver's Blood Pact Maelstrom 10.11 862.92 (16.06%) 85.34 161.33 15.75%
Resource RPS-Gain RPS-Loss
Maelstrom 17.91 17.72
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 57.96 12.40 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Sentinel + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Sentinel + Tome Damage Per Second
Count 24999
Mean 1281440.72
Minimum 1071581.08
Maximum 1588596.93
Spread ( max - min ) 517015.84
Range [ ( max - min ) / 2 * 100% ] 20.17%
Standard Deviation 68036.8361
5th Percentile 1173010.67
95th Percentile 1396299.51
( 95th Percentile - 5th Percentile ) 223288.85
Mean Distribution
Standard Deviation 430.3113
95.00% Confidence Intervall ( 1280597.33 - 1282284.12 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10829
0.1 Scale Factor Error with Delta=300 39515901
0.05 Scale Factor Error with Delta=300 158063604
0.01 Scale Factor Error with Delta=300 3951590090
Priority Target DPS
Sample Data Sentinel + Tome Priority Target Damage Per Second
Count 24999
Mean 1281440.72
Minimum 1071581.08
Maximum 1588596.93
Spread ( max - min ) 517015.84
Range [ ( max - min ) / 2 * 100% ] 20.17%
Standard Deviation 68036.8361
5th Percentile 1173010.67
95th Percentile 1396299.51
( 95th Percentile - 5th Percentile ) 223288.85
Mean Distribution
Standard Deviation 430.3113
95.00% Confidence Intervall ( 1280597.33 - 1282284.12 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10829
0.1 Scale Factor Error with Delta=300 39515901
0.05 Scale Factor Error with Delta=300 158063604
0.01 Scale Factor Error with Delta=300 3951590090
DPS(e)
Sample Data Sentinel + Tome Damage Per Second (Effective)
Count 24999
Mean 1281440.72
Minimum 1071581.08
Maximum 1588596.93
Spread ( max - min ) 517015.84
Range [ ( max - min ) / 2 * 100% ] 20.17%
Damage
Sample Data Sentinel + Tome Damage
Count 24999
Mean 330120213.98
Minimum 269088409.95
Maximum 413374049.90
Spread ( max - min ) 144285639.94
Range [ ( max - min ) / 2 * 100% ] 21.85%
DTPS
Sample Data Sentinel + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sentinel + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sentinel + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sentinel + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sentinel + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sentinel + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Sentinel + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Sentinel + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.90 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.50 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.30 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.38 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.62 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.75 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.11 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.29 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 47.57 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQLLNQQFLLLLLILLLLIALLLLILLLLLIILLLMNPPPNQLLNQQLLNIIILJLLLLILKKKGL97ILLNQAQQLNQQQLNMLPPLNPQQLLIOQQQLLILAJLLLLIILKGKKLLILLNAPLPNPLNLNMQQQLNQQQNLILLLL9IHLLJKKKIQLLFLLLIILLLALLILLLMNPPPLLIOPLLLNPPQLNIQQQALNJKIGKKLLNPPPLLIQAQQLLMNQQQL9NQQQLNQQQLNQQQNL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.108 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.246 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.101 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.956 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.810 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.949 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.805 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.662 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom bloodlust, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.517 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.517 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.9/125: 53% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.795 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.652 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.9/125: 81% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.793 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.9/125: 91% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.933 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.789 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.645 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:18.761 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:19.878 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:20.997 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:21.835 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:21.835 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.675 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:23.792 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.073 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.927 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.067 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.208 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.349 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.9/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.489 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.9/125: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.628 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.483 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.339 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.194 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.334 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:37.474 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:38.328 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.185 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.322 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.461 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.1/125: 45% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:42.940 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:44.051 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.530 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:47.011 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.4/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.123 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.4/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.235 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.9/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.687 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:52.138 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:53.227 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.679 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.9/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.769 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.8/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.882 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.995 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.587 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.700 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.812 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.292 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.772 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.251 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.364 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.476 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.586 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.698 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.808 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.918 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.399 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.512 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.512 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:17.623 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:19.105 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:20.216 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:21.328 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.810 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.810 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.291 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.773 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.224 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.7/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.313 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.765 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:31.216 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.669 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.151 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.265 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.8/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:36.377 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.8/125: 11% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.487 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.8/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.968 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.449 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.930 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.039 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:44.518 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:46.001 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:47.482 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.592 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.6/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.073 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.6/125: 98% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.185 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.940 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.420 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.899 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.380 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.2/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.860 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.2/125: 79% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.971 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.562 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.562 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.804 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.916 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.874 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.354 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.466 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.055 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom lava_surge, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.167 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.277 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.387 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.498 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.611 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:19.093 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.203 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.314 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:22.404 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:23.492 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:23.492 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:24.943 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:26.394 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:27.875 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.986 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.466 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.577 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.688 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.6/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.170 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.6/125: 89% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.282 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.395 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:37.876 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.356 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.836 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.317 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.9/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.428 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.908 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.388 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:47.870 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.982 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.6/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.465 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.6/125: 98% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.576 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.058 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.169 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.2/125: 73% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.649 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.2/125: 84% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.761 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.872 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.960 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.048 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.498 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.950 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.040 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.128 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.218 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.307 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.398 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.849 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.302 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.392 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.392 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.873 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.355 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.837 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.948 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.061 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:20.541 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.021 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.503 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.503 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.986 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.466 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.577 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.056 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.650 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.762 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.873 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.6/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.353 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.836 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.316 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.798 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.6/125: 79% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:40.909 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.6/125: 96% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:42.019 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:42.773 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:44.225 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:45.313 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:46.763 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.6/125: 68% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:47.852 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.6/125: 93% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.942 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:50.393 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:51.845 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:53.297 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:54.778 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.4/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.889 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.001 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.481 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.963 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.444 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.444 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.925 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.037 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.148 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.259 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.370 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.459 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.550 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.640 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.1/125: 44% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.730 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.1/125: 54% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.181 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.291 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.771 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.250 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.701 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.7/125: 69% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.791 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.7/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:21.242 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.332 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:23.783 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:23.783 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.265 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:26.717 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:28.168 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.258 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:30.348 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.438 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.920 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.400 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.8/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.879 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:37.358 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 79.8/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:38.470 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.8/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.581 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.061 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.541 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.022 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:45.501 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.613 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:48.091 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.572 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.052 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.532 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.643 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.123 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.603 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.085 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.195 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Sentinel + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Terror + Tome : 1277218 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1277218.0 1277218.0 862.9 / 0.068% 270148.1 / 21.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Terror + Tome 1277218
Earth Shock 289355 22.7% 49.2 5.90sec 1764508 1650005 Direct 49.2 1198990 3461291 1764545 25.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.20 49.20 0.00 0.00 1.0694 0.0000 86805125.07 86805125.07 0.00 1650005.23 1650005.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.90 75.00% 1198989.90 744671 1626190 1198507.29 1014314 1406573 44241138 44241138 0.00
crit 12.30 25.00% 3461290.81 2138696 4670418 3460095.18 2524270 4335841 42563987 42563987 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 122511 9.6% 11.3 27.12sec 3244351 3111614 Direct 11.3 90404 263980 218644 73.9%  
Periodic 211.8 49840 198241 161821 75.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 211.82 211.82 1.0427 1.4075 36754388.83 36754388.83 0.00 118582.05 3111614.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.96 26.12% 90403.55 80975 99025 89985.57 0 99025 267475 267475 0.00
crit 8.37 73.88% 263980.04 232560 284399 264040.00 249310 275280 2209522 2209522 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.0 24.54% 49839.57 398 54465 49847.73 46370 51741 2590795 2590795 0.00
crit 159.8 75.46% 198241.29 133 218991 198261.40 190424 206265 31686597 31686597 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13765 1.1% 5.1 60.40sec 804449 0 Periodic 47.0 70611 144179 87812 23.4% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 47.02 47.02 0.0000 1.2767 4129304.29 4129304.29 0.00 68781.62 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.0 76.62% 70611.30 9957 76542 70612.13 65809 76542 2544038 2544038 0.00
crit 11.0 23.38% 144178.65 20312 156146 144203.16 0 156146 1585266 1585266 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 308339 (451353) 24.1% (35.3%) 95.2 3.13sec 1422332 1079807 Direct 95.0 0 973732 973732 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.20 95.00 0.00 0.00 1.3172 0.0000 92501404.92 92501404.92 0.00 1079807.34 1079807.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.00 100.00% 973732.26 766713 1245184 972181.01 900834 1050020 92501405 92501405 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 128719 10.1% 49.9 5.89sec 774175 0 Direct 49.7 0 776220 776220 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.88 49.75 0.00 0.00 0.0000 0.0000 38615926.50 38615926.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.75 100.00% 776220.19 611027 992342 775016.28 698745 851938 38615926 38615926 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14295 1.1% 70.9 3.97sec 60510 0 Direct 70.9 47890 97712 60510 25.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.87 70.87 0.00 0.00 0.0000 0.0000 4288348.86 4288348.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.92 74.67% 47890.47 46014 51154 47890.42 46014 49618 2534247 2534247 0.00
crit 17.95 25.33% 97711.69 93868 104355 97712.90 93868 102857 1754102 1754102 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 88514 (161940) 6.9% (12.7%) 72.9 4.03sec 666547 488331 Direct 72.9 251186 713147 364323 24.5%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.88 72.88 0.00 0.00 1.3650 0.0000 26553603.01 26553603.01 0.00 488331.07 488331.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.03 75.51% 251185.79 160491 588798 252427.64 205418 342337 13823663 13823663 0.00
crit 17.85 24.49% 713147.49 460930 1691027 716042.93 482685 1259530 12729940 12729940 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73426 5.7% 69.9 5.34sec 315092 0 Direct 69.9 217277 618259 315069 24.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.91 69.91 0.00 0.00 0.0000 0.0000 22027036.99 22027036.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.86 75.61% 217277.25 134812 494590 217966.01 155520 315214 11484492 11484492 0.00
crit 17.05 24.39% 618259.10 387181 1420463 620006.22 404424 1139616 10542545 10542545 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 49921 3.9% 9.6 29.40sec 1556671 0 Direct 9.6 1233906 2517168 1556567 25.2%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.62 9.62 0.00 0.00 0.0000 0.0000 14976151.46 14976151.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.20 74.85% 1233905.72 1233906 1233906 1233856.36 0 1233906 8885168 8885168 0.00
crit 2.42 25.15% 2517167.67 2517168 2517168 2313067.55 0 2517168 6090984 6090984 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 248339 / 164015
Fire Blast 214163 11.1% 87.0 3.38sec 487731 236051 Direct 87.0 390792 781806 487741 24.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.01 87.01 0.00 0.00 2.0662 0.0000 42436257.51 42436257.51 0.00 236050.74 236050.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.44 75.21% 390792.36 372661 414301 390818.41 382355 402182 25571961 25571961 0.00
crit 21.57 24.79% 781806.47 745322 828602 781842.08 757757 818253 16864296 16864296 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34176 1.8% 10.2 30.86sec 663573 462495 Direct 10.2 115601 231386 144829 25.2%  
Periodic 102.0 41548 83017 51862 24.9% 68.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.20 10.20 102.04 102.04 1.4348 2.0006 6769538.83 6769538.83 0.00 30942.22 462494.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.63 74.75% 115600.96 110418 122756 115608.74 111209 122756 881560 881560 0.00
crit 2.58 25.25% 231385.72 220836 245512 219317.84 0 245512 595995 595995 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.7 75.13% 41547.80 7666 46033 41550.14 40167 43401 3185153 3185153 0.00
crit 25.4 24.87% 83017.39 28605 92067 83023.18 72546 89931 2106831 2106831 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182668 / 24357
Lightning Blast 182668 1.9% 37.0 7.04sec 197479 189000 Direct 37.0 159736 319503 197478 23.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7306735.54 7306735.54 0.00 188999.88 188999.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.26 76.38% 159736.35 153358 170494 159735.66 155133 166965 4513992 4513992 0.00
crit 8.74 23.62% 319503.25 306717 340988 319493.55 0 340988 2792743 2792743 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Terror + Tome
Ascendance 2.0 186.20sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 100.17sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.69sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.44sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.2sec 50.2sec 26.87% 46.19% 0.0(0.0) 5.6

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.4 51.5 4.5sec 2.5sec 69.37% 73.75% 51.5(60.2) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.14%
  • elemental_focus_2:40.23%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 7.98% 23.49% 0.7(0.7) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 30.00% 30.00% 4.3(4.3) 12.6

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.4sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.9sec 19.7sec 37.49% 34.08% 5.9(16.2) 0.7

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.23%
  • power_of_the_maelstrom_2:6.24%
  • power_of_the_maelstrom_3:25.01%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.36% 11.33% 0.0(0.0) 0.2

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.22%
  • stormkeeper_2:3.09%
  • stormkeeper_3:4.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 96.64% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.7 85.2sec
Lava Surge: During Lava Burst 7.5 35.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6750.0017.6452.2570.00010.624
Fire Elemental0.4410.0011.4810.6630.0004.028
Ascendance6.3030.00168.9656.2350.00068.965
Lava Burst0.8220.00010.2645.5280.00023.581

Resources

Resource Usage Type Count Total Average RPE APR
Terror + Tome
earth_shock Maelstrom 49.2 4958.4 100.8 100.8 17506.5
flame_shock Maelstrom 11.3 207.6 18.3 18.3 177063.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.20 1117.53 (21.40%) 11.74 24.88 2.18%
Lava Burst Overload Maelstrom 49.88 426.83 (8.17%) 8.56 22.10 4.92%
Lightning Bolt Maelstrom 72.88 583.07 (11.17%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 69.90 416.58 (7.98%) 5.96 2.84 0.68%
Aftershock Maelstrom 60.52 1549.81 (29.68%) 25.61 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.97 (5.57%) 0.97 7.61 2.55%
The Deceiver's Blood Pact Maelstrom 9.83 837.27 (16.03%) 85.20 153.34 15.48%
Resource RPS-Gain RPS-Loss
Maelstrom 17.41 17.22
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.29 11.40 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Terror + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Terror + Tome Damage Per Second
Count 24999
Mean 1277217.98
Minimum 1057019.93
Maximum 1565007.18
Spread ( max - min ) 507987.25
Range [ ( max - min ) / 2 * 100% ] 19.89%
Standard Deviation 69606.4839
5th Percentile 1165016.61
95th Percentile 1395494.07
( 95th Percentile - 5th Percentile ) 230477.46
Mean Distribution
Standard Deviation 440.2389
95.00% Confidence Intervall ( 1276355.12 - 1278080.83 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11410
0.1 Scale Factor Error with Delta=300 41360242
0.05 Scale Factor Error with Delta=300 165440965
0.01 Scale Factor Error with Delta=300 4136024113
Priority Target DPS
Sample Data Terror + Tome Priority Target Damage Per Second
Count 24999
Mean 1277217.98
Minimum 1057019.93
Maximum 1565007.18
Spread ( max - min ) 507987.25
Range [ ( max - min ) / 2 * 100% ] 19.89%
Standard Deviation 69606.4839
5th Percentile 1165016.61
95th Percentile 1395494.07
( 95th Percentile - 5th Percentile ) 230477.46
Mean Distribution
Standard Deviation 440.2389
95.00% Confidence Intervall ( 1276355.12 - 1278080.83 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11410
0.1 Scale Factor Error with Delta=300 41360242
0.05 Scale Factor Error with Delta=300 165440965
0.01 Scale Factor Error with Delta=300 4136024113
DPS(e)
Sample Data Terror + Tome Damage Per Second (Effective)
Count 24999
Mean 1277217.98
Minimum 1057019.93
Maximum 1565007.18
Spread ( max - min ) 507987.25
Range [ ( max - min ) / 2 * 100% ] 19.89%
Damage
Sample Data Terror + Tome Damage
Count 24999
Mean 326651289.93
Minimum 260235933.47
Maximum 404062437.78
Spread ( max - min ) 143826504.31
Range [ ( max - min ) / 2 * 100% ] 22.02%
DTPS
Sample Data Terror + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Terror + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Terror + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Terror + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Terror + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Terror + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Terror + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Terror + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.13 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.43 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 19.25 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.31 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.49 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.83 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 29.94 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.41 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 48.52 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHKKKFLLLILLLLLILLLLLIPPNPQQLNLILLLLLILGLPNLLLLLIILLJAKKKIQLLMLNQQLQN97QQLQNQQLNNMQLQLNQQQLLNOPPPLNQQAJNLQMQQLNLIQQQLNPPPNLLLLLLILLLMNPPPLNQQQLNIHLQAQJLNQQQL9FLLLLILLLLLIILLMNQQQQLNOQQQLNLLLLLILLMANPJKKLLKIPPQLNQQLNLLLMNPPLPNQQQLNNQQL9LNPPPL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.105 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.223 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.061 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.899 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.738 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.576 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.576 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.3/125: 74% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.835 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.3/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.976 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.830 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.967 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.7/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.108 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:15.247 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.7/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:16.389 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.7/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:17.506 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:18.344 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:19.462 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:20.579 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:21.696 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:22.812 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:23.951 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:24.806 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:25.946 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.088 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.944 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.082 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.222 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.361 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.499 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.1/125: 70% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.354 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.2/125: 91% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.492 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.348 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.488 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.629 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.484 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.625 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.766 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.620 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.101 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.213 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.694 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.175 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.286 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.766 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.878 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.359 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.8/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.838 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.8/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.318 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.430 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.542 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.024 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.505 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.616 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.616 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.728 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.840 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.953 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.066 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.547 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.027 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.138 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.250 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.362 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:13.451 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.7/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:14.903 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:16.354 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:17.804 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:19.254 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:20.365 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 29.9/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:21.477 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:21.477 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:22.959 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:24.440 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.9/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:25.921 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:27.402 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.9/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:28.513 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.992 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.472 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.951 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.062 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.6/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:35.175 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:36.288 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.8/125: 16% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:37.771 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:38.885 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.8/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.365 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.844 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:42.957 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.438 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.918 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.399 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.880 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:49.968 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.3/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:51.059 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:51.815 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:53.265 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.717 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.168 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.1/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.647 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.1/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.759 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.241 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.722 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.722 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.833 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.944 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.2/125: 19% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.424 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.535 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.2/125: 43% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.646 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.2/125: 32% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.756 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.866 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.978 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.2/125: 67% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.088 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.1/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.568 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.1/125: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.679 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:16.159 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:17.641 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:19.121 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:20.600 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:21.712 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:23.191 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.4/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:24.672 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.4/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:26.152 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.4/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.266 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:28.718 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.2/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:30.170 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.2/125: 53% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.620 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.2/125: 63% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.072 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.2/125: 75% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.551 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.2/125: 85% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.033 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.144 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.623 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.732 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.213 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.324 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.436 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.7/125: 21% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.915 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.394 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.876 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.357 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.7/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.468 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.9/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.948 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.427 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.909 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.389 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.9/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.500 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.611 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.723 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.835 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.316 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.316 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.796 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.907 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.389 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.500 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.9/125: 20% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.589 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.680 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.768 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.221 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.311 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.311 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.763 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.9/125: 69% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:16.213 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.9/125: 80% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:17.664 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.9/125: 90% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:19.116 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:20.207 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:21.299 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:22.750 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:24.203 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:25.657 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:27.139 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.252 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.365 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.846 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.298 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.388 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.477 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.5/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.927 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.378 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.831 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.281 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.732 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.821 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.575 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.055 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.537 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.017 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.499 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.613 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.723 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.204 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.1/125: 50% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.684 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.165 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.647 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.1/125: 97% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.757 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.237 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.719 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.4/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.830 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.830 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.940 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.4/125: 18% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.422 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 31.4/125: 25% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.534 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.645 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.756 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.4/125: 64% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.868 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.4/125: 76% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.348 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.4/125: 86% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.460 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.574 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.025 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:16.474 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:17.925 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:19.377 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:20.490 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:21.970 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:23.450 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.9/125: 45% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:24.561 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.9/125: 60% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:25.649 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:26.738 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:28.190 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:29.278 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.1/125: 73% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.366 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.1/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.479 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.5/125: 20% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.960 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.442 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:35.892 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:37.344 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:38.432 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.884 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.335 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.815 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.296 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.408 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.3/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.519 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.9/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.000 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.481 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.591 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 87.9/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.703 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.186 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.9/125: 82% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.296 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.776 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.257 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.739 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Terror + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=terror_from_below,id=147016,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Sentinel : 1257139 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1257138.6 1257138.6 810.0 / 0.064% 254029.5 / 20.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Sentinel 1257139
Earth Shock 271591 21.6% 50.4 5.78sec 1617839 1513173 Direct 50.4 1175654 3374556 1617847 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.36 50.36 0.00 0.00 1.0692 0.0000 81476797.31 81476797.31 0.00 1513172.95 1513172.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.23 79.89% 1175653.80 724942 1591741 1175315.29 987502 1371122 47302379 47302379 0.00
crit 10.13 20.11% 3374556.13 2082035 4571481 3372826.34 2286694 4313054 34174418 34174418 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 116916 9.3% 11.3 27.13sec 3098161 2970501 Direct 11.3 88021 257690 209813 71.8%  
Periodic 211.8 48527 194423 154365 72.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 211.83 211.83 1.0430 1.4074 35075681.15 35075681.15 0.00 113165.25 2970501.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.19 28.22% 88021.43 78830 96927 87772.72 0 94963 281217 281217 0.00
crit 8.13 71.78% 257690.35 226399 278375 257754.78 244514 269541 2094151 2094151 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.2 27.45% 48527.26 396 53311 48535.81 45413 50583 2822261 2822261 0.00
crit 153.7 72.55% 194422.99 780 214353 194451.08 186447 202528 29878052 29878052 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 293164 (446201) 23.3% (35.5%) 95.4 3.11sec 1403050 1064896 Direct 95.2 0 923739 923739 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.41 95.21 0.00 0.00 1.3175 0.0000 87947850.06 87947850.06 0.00 1064896.34 1064896.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.21 100.00% 923738.67 746400 1117784 922340.60 854978 986762 87947850 87947850 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 139667 11.1% 57.1 5.16sec 734356 0 Direct 56.9 0 736282 736282 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.06 56.91 0.00 0.00 0.0000 0.0000 41899451.91 41899451.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 56.91 100.00% 736282.02 594839 890811 735170.68 671570 793467 41899452 41899452 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13371 1.1% 71.1 3.94sec 56446 0 Direct 71.1 46725 95321 56446 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.06 71.06 0.00 0.00 0.0000 0.0000 4011232.32 4011232.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.85 80.00% 46724.78 44795 50071 46725.00 45179 48752 2656196 2656196 0.00
crit 14.22 20.00% 95320.80 91382 102145 95319.12 91382 102145 1355037 1355037 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 80660 (152781) 6.4% (12.2%) 71.9 4.09sec 637848 467506 Direct 71.9 244645 703514 336730 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.86 71.86 0.00 0.00 1.3644 0.0000 24197674.65 24197674.65 0.00 467505.73 467505.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.44 79.93% 244645.24 156239 576325 245890.28 196301 344320 14051517 14051517 0.00
crit 14.42 20.07% 703513.71 448719 1655205 707189.76 465019 1492011 10146157 10146157 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 72120 5.7% 74.5 5.09sec 290372 0 Direct 74.5 211279 606727 290367 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.51 74.51 0.00 0.00 0.0000 0.0000 21635652.07 21635652.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.61 80.00% 211279.05 131241 484113 212063.72 156016 320290 12594453 12594453 0.00
crit 14.90 20.00% 606727.06 376924 1390373 608815.68 392334 1273380 9041199 9041199 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31387 2.5% 16.1 18.32sec 583113 0 Direct 16.0 487076 993635 588814 20.1%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.15 15.99 0.00 0.00 0.0000 0.0000 9415901.26 9415901.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.78 79.91% 487076.02 487076 487076 487076.02 487076 487076 6224496 6224496 0.00
crit 3.21 20.09% 993635.07 993635 993635 959015.44 0 993635 3191405 3191405 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
Spectral Owl 0 (64512) 0.0% (5.1%) 3.0 120.40sec 6450793 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 322539.67 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 20342 1.6% 36.3 7.34sec 168156 0 Direct 36.3 138975 283509 168151 20.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.29 36.29 0.00 0.00 0.0000 0.0000 6102137.88 6102137.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.96 79.81% 138975.15 138975 138975 138975.15 138975 138975 4025032 4025032 0.00
crit 7.33 20.19% 283509.31 283509 283509 283350.54 0 283509 2077106 2077106 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 44170 3.5% 92.0 2.86sec 144024 0 Direct 92.0 119121 243007 144025 20.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.00 92.00 0.00 0.00 0.0000 0.0000 13250242.17 13250242.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.51 79.90% 119120.85 119121 119121 119120.85 119121 119121 8756114 8756114 0.00
crit 18.49 20.10% 243006.52 243007 243007 243006.52 243007 243007 4494129 4494129 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - primal_fire_elemental 233682 / 150658
Fire Blast 201497 10.3% 85.0 3.41sec 458275 222123 Direct 85.0 381665 763385 458266 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.05 85.05 0.00 0.00 2.0632 0.0000 38974725.00 38974725.00 0.00 222122.50 222122.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.98 79.93% 381664.99 362788 405524 381690.28 373385 392972 25944849 25944849 0.00
crit 17.07 20.07% 763385.05 725575 811049 763421.16 734342 799214 13029876 13029876 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32185 1.7% 10.0 31.26sec 623624 434848 Direct 10.0 112887 225734 135554 20.1%  
Periodic 100.1 40545 81104 48673 20.0% 66.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.98 9.98 100.07 100.07 1.4342 1.9982 6223539.67 6223539.67 0.00 29045.18 434847.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.98 79.92% 112886.82 107493 120155 112893.20 107493 120155 900321 900321 0.00
crit 2.00 20.08% 225733.83 214985 240311 201905.61 0 240311 452419 452419 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.0 79.96% 40545.37 13955 45058 40546.30 39235 42507 3244212 3244212 0.00
crit 20.1 20.04% 81103.68 27909 90117 81104.32 63895 87560 1626588 1626588 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 173183 / 23093
Lightning Blast 173183 1.8% 37.0 7.04sec 187225 179186 Direct 37.0 155815 311752 187226 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6927319.40 6927319.40 0.00 179185.71 179185.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.55 79.86% 155814.75 149295 166882 155814.59 151189 163074 4603941 4603941 0.00
crit 7.45 20.14% 311751.80 298591 333765 311689.55 0 333765 2323378 2323378 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Sentinel
Ascendance 2.0 186.04sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 102.02sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.86 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.67sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.61sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.7sec 49.7sec 27.44% 46.57% 0.0(0.0) 5.7

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.20% 32.20% 3.1(3.1) 8.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.4 48.0 4.5sec 2.6sec 66.87% 71.83% 48.0(55.4) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.83%
  • elemental_focus_2:38.04%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 8.02% 23.45% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.02%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.93% 29.93% 4.2(4.2) 12.6

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.6sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 35.0sec 19.7sec 37.87% 34.49% 5.9(16.3) 0.7

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.27%
  • power_of_the_maelstrom_2:6.23%
  • power_of_the_maelstrom_3:25.38%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.1 0.0 18.3sec 18.3sec 16.07% 16.07% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.45% 11.51% 0.0(0.0) 0.2

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.25%
  • stormkeeper_2:3.12%
  • stormkeeper_3:4.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.57% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 81.7sec
Lava Surge: During Lava Burst 7.5 35.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6800.0018.9202.2800.00010.159
Fire Elemental0.4060.0011.4810.5710.0003.926
Ascendance6.4630.00175.4706.3940.00075.470
Lava Burst0.8150.0009.4745.4570.00021.368

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Sentinel
earth_shock Maelstrom 50.4 5101.6 101.3 101.3 15970.7
flame_shock Maelstrom 11.3 207.4 18.3 18.3 169099.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.40 1118.17 (20.84%) 11.72 26.61 2.32%
Lava Burst Overload Maelstrom 57.05 487.23 (9.08%) 8.54 26.23 5.11%
Lightning Bolt Maelstrom 71.86 574.91 (10.71%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 74.51 443.92 (8.27%) 5.96 3.17 0.71%
Aftershock Maelstrom 61.68 1592.72 (29.68%) 25.82 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.52 (5.41%) 0.97 8.06 2.70%
The Deceiver's Blood Pact Maelstrom 10.06 858.60 (16.00%) 85.32 160.28 15.73%
Resource RPS-Gain RPS-Loss
Maelstrom 17.89 17.70
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.29 12.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Thurible + Sentinel Damage Per Second
Count 24999
Mean 1257138.62
Minimum 1040096.13
Maximum 1532333.66
Spread ( max - min ) 492237.53
Range [ ( max - min ) / 2 * 100% ] 19.58%
Standard Deviation 65340.3903
5th Percentile 1153332.11
95th Percentile 1367615.24
( 95th Percentile - 5th Percentile ) 214283.12
Mean Distribution
Standard Deviation 413.2572
95.00% Confidence Intervall ( 1256328.65 - 1257948.59 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10378
0.1 Scale Factor Error with Delta=300 36445769
0.05 Scale Factor Error with Delta=300 145783076
0.01 Scale Factor Error with Delta=300 3644576898
Priority Target DPS
Sample Data Thurible + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1257138.62
Minimum 1040096.13
Maximum 1532333.66
Spread ( max - min ) 492237.53
Range [ ( max - min ) / 2 * 100% ] 19.58%
Standard Deviation 65340.3903
5th Percentile 1153332.11
95th Percentile 1367615.24
( 95th Percentile - 5th Percentile ) 214283.12
Mean Distribution
Standard Deviation 413.2572
95.00% Confidence Intervall ( 1256328.65 - 1257948.59 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10378
0.1 Scale Factor Error with Delta=300 36445769
0.05 Scale Factor Error with Delta=300 145783076
0.01 Scale Factor Error with Delta=300 3644576898
DPS(e)
Sample Data Thurible + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1257138.62
Minimum 1040096.13
Maximum 1532333.66
Spread ( max - min ) 492237.53
Range [ ( max - min ) / 2 * 100% ] 19.58%
Damage
Sample Data Thurible + Sentinel Damage
Count 24999
Mean 325012620.79
Minimum 264249403.95
Maximum 404545072.68
Spread ( max - min ) 140295668.73
Range [ ( max - min ) / 2 * 100% ] 21.58%
DTPS
Sample Data Thurible + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.86 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.50 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.08 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.27 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.36 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.70 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.75 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.09 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.31 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 47.54 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQLLFILLLLLILLLLIILLLNPPPNQQLNMQQQQQLNILLLLLILLLLJIKLLMQNQQLLNIQQLLNI97QQLLNQQQLNMQLQLNQLQNLOQQNQQAJLNMNQLQNQQQQLNQQQLNQQLNLQMQQQLLNLQQNLIQQQNLHQLJQLNQQFLLLILLLL9IILLPNPPQLLIGQQLOQNQQQLLNILLNMALLJLLLLILLQLKIILPPNQLLMNNIILQNLQQLLNPLPNLPQNQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.971 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.206 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.043 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.883 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.722 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.561 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.416 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.3/125: 79% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.269 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.269 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.124 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.264 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.404 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.542 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.397 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.535 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.390 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.529 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.668 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.808 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.3/125: 83% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:20.925 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:21.766 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.601 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:23.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:24.835 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:25.952 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.808 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.948 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:29.065 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:30.181 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:31.020 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:32.138 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.255 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:34.372 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.7/125: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:35.227 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:36.081 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.6/125: 8% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:37.223 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.6/125: 16% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.363 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:39.501 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:40.642 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:41.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.260 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.6/125: 75% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.370 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.482 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.964 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.444 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.925 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.406 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.884 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.997 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.477 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:56.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:58.438 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.921 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.112 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.225 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.337 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.8/125: 42% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.450 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:05.931 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:07.043 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.155 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.267 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.377 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.860 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:12.972 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.1/125: 62% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:14.453 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.1/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.564 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.677 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.157 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.638 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.729 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.180 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.270 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.359 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.447 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.447 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:26.897 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.377 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.858 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:30.972 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.084 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:33.564 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:35.045 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:36.497 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:37.948 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:39.037 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.1/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:40.125 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.1/125: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:41.576 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:42.686 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.1/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:44.167 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:45.648 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:46.759 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.349 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.829 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.422 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.176 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:55.628 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.079 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.169 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.620 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:01.071 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:01.071 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:02.220 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.8/125: 50% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:03.699 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.810 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.6/125: 88% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.923 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.6/125: 77% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.034 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.123 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.574 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:10.662 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:11.750 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:12.839 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.321 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.801 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.6/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.281 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.6/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.761 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.6/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.874 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.357 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.838 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:24.318 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
2:25.799 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:26.909 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.389 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.872 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.983 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.094 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.4/125: 20% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.576 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.057 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.169 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.649 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:39.129 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:40.609 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:41.721 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.202 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.315 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.426 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.906 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.386 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.474 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.4/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.925 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.4/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.014 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.5/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.465 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:54.916 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:56.398 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.511 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.4/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.992 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:00.104 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:01.584 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:02.694 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.806 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.916 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.398 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.510 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.620 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.731 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.731 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.210 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.9/125: 59% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.692 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.9/125: 78% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.173 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.9/125: 95% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.285 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.766 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.247 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:19.699 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:21.150 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:22.240 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:23.328 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.417 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.897 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.378 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.858 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.967 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.446 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:32.898 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:34.350 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.802 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.7/125: 79% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:36.891 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.7/125: 97% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:37.980 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.091 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.569 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.049 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.528 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:44.282 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:45.764 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.7/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:46.876 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.6/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.357 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.838 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.6/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.319 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.6/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.432 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.6/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.913 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.6/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.023 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.135 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.248 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.728 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.839 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.950 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 10.7/125: 9% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.950 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.7/125: 9% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.429 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.909 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.019 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.498 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.951 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.7/125: 74% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.403 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.7/125: 85% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.854 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.394 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:14.505 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:15.615 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:16.724 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.834 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.946 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.059 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.541 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:23.022 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.503 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:25.594 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:27.045 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:28.498 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.588 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.3/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.676 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.785 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:32.897 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:34.011 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.123 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.604 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.055 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.147 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.5/125: 23% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.238 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:41.689 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:43.139 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.251 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.733 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.845 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.326 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.9/125: 34% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:49.437 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.9/125: 54% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:50.919 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:52.008 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.460 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:54.910 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:56.363 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:57.474 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.3/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.926 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Terror : 1249501 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1249500.9 1249500.9 845.5 / 0.068% 267191.9 / 21.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 48.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Terror 1249501
Earth Shock 276051 22.1% 49.2 5.94sec 1683674 1574517 Direct 49.2 1171528 3362815 1683722 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.19 49.19 0.00 0.00 1.0693 0.0000 82814865.29 82814865.29 0.00 1574516.90 1574516.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.69 76.63% 1171527.87 724942 1591741 1171064.03 996868 1368030 44153995 44153995 0.00
crit 11.50 23.37% 3362814.60 2082035 4571481 3360432.48 2292637 4472656 38660870 38660870 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 118616 9.5% 11.3 27.13sec 3141093 3012145 Direct 11.3 88124 257637 212717 73.5%  
Periodic 211.8 48573 193787 156627 74.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 211.82 211.82 1.0429 1.4075 35585478.95 35585478.95 0.00 114810.76 3012144.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.00 26.50% 88123.81 78830 96927 87638.63 0 96927 264576 264576 0.00
crit 8.33 73.50% 257636.57 226399 278375 257701.29 246840 269541 2145266 2145266 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.2 25.59% 48573.41 65 53311 48581.25 45619 50534 2632926 2632926 0.00
crit 157.6 74.41% 193786.78 407 214353 193809.51 185864 201714 30542711 30542711 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 296944 (434835) 23.8% (34.8%) 95.2 3.11sec 1370304 1040292 Direct 95.0 0 937707 937707 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.20 95.00 0.00 0.00 1.3172 0.0000 89081572.78 89081572.78 0.00 1040291.63 1040291.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.00 100.00% 937706.92 746400 1148070 936142.34 867289 1013232 89081573 89081573 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 124174 9.9% 50.0 5.86sec 745508 0 Direct 49.8 0 747476 747476 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.97 49.84 0.00 0.00 0.0000 0.0000 37251654.17 37251654.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.84 100.00% 747476.32 594839 914948 746218.54 673493 813253 37251654 37251654 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13718 1.1% 70.9 3.92sec 58041 0 Direct 70.9 46724 95326 58041 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.90 70.90 0.00 0.00 0.0000 0.0000 4115182.56 4115182.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.39 76.71% 46723.79 44795 50071 46723.86 44880 48590 2541343 2541343 0.00
crit 16.51 23.29% 95326.23 91382 102145 95324.48 91382 102145 1573839 1573839 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 85388 (156396) 6.8% (12.5%) 72.9 4.04sec 643565 471476 Direct 72.9 244296 701532 351371 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.90 72.90 0.00 0.00 1.3650 0.0000 25616004.71 25616004.71 0.00 471476.24 471476.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.83 76.58% 244296.12 156239 576325 245501.41 192860 352208 13638560 13638560 0.00
crit 17.07 23.42% 701532.10 448719 1655205 704309.37 463676 1350640 11977444 11977444 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 71008 5.7% 70.0 5.34sec 304238 0 Direct 70.0 211363 607927 304241 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.02 70.02 0.00 0.00 0.0000 0.0000 21302009.96 21302009.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.62 76.58% 211362.80 131241 484113 212020.88 150439 306363 11332708 11332708 0.00
crit 16.40 23.42% 607927.23 376924 1390373 609813.08 397295 1116532 9969302 9969302 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 32368 2.6% 16.2 18.46sec 600541 0 Direct 16.0 487076 993635 606454 23.6%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.17 16.01 0.00 0.00 0.0000 0.0000 9710200.47 9710200.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.24 76.43% 487076.02 487076 487076 487076.02 487076 487076 5960549 5960549 0.00
crit 3.77 23.57% 993635.07 993635 993635 975112.97 0 993635 3749652 3749652 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
Terror From Below 50537 4.0% 9.6 29.65sec 1574167 0 Direct 9.6 1266400 2583456 1574129 23.4%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.63 9.63 0.00 0.00 0.0000 0.0000 15161216.66 15161216.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.38 76.63% 1266400.24 1266400 1266400 1266349.58 0 1266400 9346864 9346864 0.00
crit 2.25 23.37% 2583456.50 2583456 2583456 2338121.65 0 2583456 5814353 5814353 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 239774 / 156963
Fire Blast 206796 10.8% 86.3 3.39sec 470768 227961 Direct 86.3 381495 763018 470769 23.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.27 86.27 0.00 0.00 2.0651 0.0000 40615409.15 40615409.15 0.00 227961.30 227961.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.09 76.60% 381494.95 362788 405524 381518.98 373365 393209 25211999 25211999 0.00
crit 20.19 23.40% 763017.54 725575 811049 763089.10 739136 799214 15403410 15403410 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32977 1.7% 10.1 31.05sec 639794 445970 Direct 10.1 112841 225698 139208 23.4%  
Periodic 101.3 40536 81072 50005 23.4% 67.5%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 10.12 101.31 101.31 1.4346 1.9997 6474590.16 6474590.16 0.00 29822.25 445969.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 76.63% 112840.63 107493 120155 112850.18 108467 120155 875028 875028 0.00
crit 2.37 23.37% 225697.76 214985 240311 210266.07 0 240311 533834 533834 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.6 76.64% 40536.40 9586 45058 40538.32 39148 42423 3147511 3147511 0.00
crit 23.7 23.36% 81072.39 16321 90117 81075.95 70326 87333 1918218 1918218 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 178002 / 23735
Lightning Blast 178002 1.9% 37.0 7.03sec 192434 184167 Direct 37.0 155847 311796 192438 23.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7120070.28 7120070.28 0.00 184166.74 184166.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.32 76.54% 155847.32 149295 166882 155847.36 150856 163049 4413500 4413500 0.00
crit 8.68 23.46% 311796.21 298591 333765 311794.56 298591 333765 2706570 2706570 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Terror
Ascendance 2.0 186.35sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 100.81sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.67sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.88sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.2sec 50.2sec 26.89% 46.22% 0.0(0.0) 5.6

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.23% 32.23% 3.1(3.1) 8.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.1 50.5 4.5sec 2.5sec 68.76% 73.25% 50.5(58.8) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.08%
  • elemental_focus_2:39.69%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.1sec 13.6sec 7.97% 23.50% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.97%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.2sec 17.1sec 29.94% 29.94% 4.3(4.3) 12.6

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.9sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.8sec 19.7sec 37.56% 34.21% 5.9(16.2) 0.7

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.27%
  • power_of_the_maelstrom_2:6.26%
  • power_of_the_maelstrom_3:25.03%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.09% 16.09% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.34% 11.34% 0.0(0.0) 0.2

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.21%
  • stormkeeper_2:3.09%
  • stormkeeper_3:4.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.28% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.6sec
Lava Surge: Wasted 0.7 83.7sec
Lava Surge: During Lava Burst 7.5 35.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6770.0018.7842.2580.00011.896
Fire Elemental0.4320.0011.4820.6330.0003.901
Ascendance6.3010.00272.2626.2310.00072.262
Lava Burst0.8190.00010.0125.4980.00021.404

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Terror
earth_shock Maelstrom 49.2 4960.8 100.9 100.9 16694.0
flame_shock Maelstrom 11.3 207.6 18.3 18.3 171430.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.20 1117.72 (21.39%) 11.74 24.71 2.16%
Lava Burst Overload Maelstrom 49.97 427.53 (8.18%) 8.55 22.25 4.95%
Lightning Bolt Maelstrom 72.90 583.18 (11.16%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 70.02 417.25 (7.99%) 5.96 2.85 0.68%
Aftershock Maelstrom 60.52 1550.50 (29.68%) 25.62 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.96 (5.57%) 0.97 7.62 2.55%
The Deceiver's Blood Pact Maelstrom 9.82 837.45 (16.03%) 85.24 153.82 15.52%
Resource RPS-Gain RPS-Loss
Maelstrom 17.41 17.23
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.73 11.50 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Thurible + Terror Damage Per Second
Count 24999
Mean 1249500.93
Minimum 1003788.35
Maximum 1566484.61
Spread ( max - min ) 562696.26
Range [ ( max - min ) / 2 * 100% ] 22.52%
Standard Deviation 68209.4087
5th Percentile 1141083.40
95th Percentile 1364618.89
( 95th Percentile - 5th Percentile ) 223535.49
Mean Distribution
Standard Deviation 431.4028
95.00% Confidence Intervall ( 1248655.40 - 1250346.46 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11448
0.1 Scale Factor Error with Delta=300 39716616
0.05 Scale Factor Error with Delta=300 158866464
0.01 Scale Factor Error with Delta=300 3971661599
Priority Target DPS
Sample Data Thurible + Terror Priority Target Damage Per Second
Count 24999
Mean 1249500.93
Minimum 1003788.35
Maximum 1566484.61
Spread ( max - min ) 562696.26
Range [ ( max - min ) / 2 * 100% ] 22.52%
Standard Deviation 68209.4087
5th Percentile 1141083.40
95th Percentile 1364618.89
( 95th Percentile - 5th Percentile ) 223535.49
Mean Distribution
Standard Deviation 431.4028
95.00% Confidence Intervall ( 1248655.40 - 1250346.46 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11448
0.1 Scale Factor Error with Delta=300 39716616
0.05 Scale Factor Error with Delta=300 158866464
0.01 Scale Factor Error with Delta=300 3971661599
DPS(e)
Sample Data Thurible + Terror Damage Per Second (Effective)
Count 24999
Mean 1249500.93
Minimum 1003788.35
Maximum 1566484.61
Spread ( max - min ) 562696.26
Range [ ( max - min ) / 2 * 100% ] 22.52%
Damage
Sample Data Thurible + Terror Damage
Count 24999
Mean 320638185.56
Minimum 254407461.94
Maximum 406313526.30
Spread ( max - min ) 151906064.36
Range [ ( max - min ) / 2 * 100% ] 23.69%
DTPS
Sample Data Thurible + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.93 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.44 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 19.31 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 95.49 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.82 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 29.88 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.48 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 48.44 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKJGJJKEKKKKHKKKKHHKKKKKHKKOKMOOPKLMPPPKMKKKKKKHKKKKKHKKIKJJHJPKK97FKMKKKKKHKKKMOOOMKLPPPMKKKKKHKKMMNOOOIKMLPPPKMPPPKKMHOOOKHKPPKLKKHPKMKKKKKKHK9KMOGKOKIJKKHKPMMKJEKKKHHKKKKHKKKLMOOOPKKHPNPKKMPPPKMLMPPIKKMPPPPKMMHPPKMPPPKMLP9PPKMPPPKMKPPPKKHOO

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.969 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:03.085 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:03.925 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:04.763 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.3/125: 12% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.603 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.441 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.558 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.558 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.697 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.553 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.409 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.3/125: 85% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.546 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.3/125: 95% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.402 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.542 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.681 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.820 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.960 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.816 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.673 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.529 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.668 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.807 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.947 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.801 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.657 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.512 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.650 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.789 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.643 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.498 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.637 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.775 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.915 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.056 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.8/125: 77% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:34.912 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.8/125: 66% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:35.767 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:36.907 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:38.047 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:39.165 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.003 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.840 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.8/125: 21% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.956 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.044 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.495 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.8/125: 68% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.974 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.8/125: 78% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.453 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.8/125: 89% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.933 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.047 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.528 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.007 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.457 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.545 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.997 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.086 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.566 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.044 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.156 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.636 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.727 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.4/125: 88% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.817 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.906 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.995 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:09.446 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:10.536 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.017 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.130 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.130 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:14.241 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:15.352 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:16.464 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:17.946 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:19.428 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:20.910 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.390 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:23.870 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.983 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:26.093 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.573 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.054 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.167 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.648 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.129 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.609 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.1/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:35.719 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:37.198 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:38.309 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:39.789 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:41.269 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.9/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:42.750 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:43.863 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:45.345 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:46.798 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:48.250 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.7/125: 72% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:49.701 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:51.154 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:52.242 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:53.723 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:55.204 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.317 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.427 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.182 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.664 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.144 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.625 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.735 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.8/125: 73% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.215 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.8/125: 83% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.325 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.438 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.7/125: 24% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.550 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.662 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.773 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.253 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.364 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.2/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:14.844 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:16.325 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:17.777 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.2/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:18.867 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.2/125: 70% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:20.317 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.2/125: 80% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:21.405 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:22.494 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:23.945 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.425 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.906 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.018 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.129 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.609 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.090 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.569 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.2/125: 68% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.681 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.2/125: 91% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.792 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.2/125: 80% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.905 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.2/125: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.387 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.498 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.979 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:42.069 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.158 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:44.248 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:45.698 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:47.149 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.628 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.108 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.588 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.700 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.179 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.290 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.770 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.2/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.881 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.363 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.475 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.585 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.066 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.177 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.290 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.401 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.4/125: 74% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.513 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.4/125: 92% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.994 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.108 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.220 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:12.333 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:13.444 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.555 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.035 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.146 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.146 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.627 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.738 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.217 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:22.305 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.395 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.485 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.936 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.389 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.841 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.931 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.382 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:32.835 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:34.287 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:35.376 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:36.465 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:37.916 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.1/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:39.366 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.1/125: 38% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:40.817 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.299 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.779 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.1/125: 84% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.891 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.004 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.486 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.240 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.722 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:50.834 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:52.314 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.425 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:54.878 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:56.329 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:57.781 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:59.233 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.322 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.7/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.434 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.7/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.545 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.027 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.506 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.618 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.4/125: 44% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.098 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.210 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.4/125: 80% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.323 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:11.435 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:12.547 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.1/125: 45% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.659 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.137 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.620 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.1/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.731 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.841 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.953 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.434 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.913 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.395 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.505 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.985 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.465 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.947 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.429 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.518 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.608 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:35.060 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:36.150 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:37.603 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.053 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:40.503 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.616 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.097 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.578 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.059 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.7/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.540 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.651 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.762 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.244 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.724 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.1/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.204 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:55.686 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.1/125: 74% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:56.799 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.1/125: 98% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:57.910 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.392 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Tome : 1254216 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1254216.2 1254216.2 839.4 / 0.067% 262340.9 / 20.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Tome 1254216
Earth Shock 284120 22.7% 49.2 5.90sec 1733633 1621129 Direct 49.2 1229571 3552219 1733681 21.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.17 49.17 0.00 0.00 1.0694 0.0000 85235731.23 85235731.23 0.00 1621129.20 1621129.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.50 78.30% 1229571.27 764282 1669015 1229039.00 1031931 1436569 47333165 47333165 0.00
crit 10.67 21.70% 3552218.86 2195018 4793412 3550633.80 2527282 4601676 37902566 37902566 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 123816 9.9% 11.3 27.10sec 3280694 3145814 Direct 11.3 92736 270997 221324 72.1%  
Periodic 211.8 51118 204102 163528 73.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 211.83 211.83 1.0429 1.4075 37145767.57 37145767.57 0.00 119844.00 3145813.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.16 27.87% 92736.30 83107 101633 92517.91 0 99668 292623 292623 0.00
crit 8.17 72.13% 270997.02 238684 291889 271057.73 259542 282850 2213269 2213269 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.2 26.52% 51117.95 199 55899 51127.25 47778 53109 2871794 2871794 0.00
crit 155.6 73.48% 204101.99 152 224758 204128.96 194541 212172 31768082 31768082 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 13742 1.1% 5.1 60.42sec 803377 0 Periodic 47.0 72474 147980 87661 20.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 47.02 47.02 0.0000 1.2767 4122291.37 4122291.37 0.00 68663.66 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.89% 72474.22 10219 78558 72474.40 67276 78558 2722570 2722570 0.00
crit 9.5 20.11% 147980.42 20847 160258 147942.47 0 160258 1399721 1399721 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 311455 (455869) 24.8% (36.3%) 95.2 3.14sec 1437157 1091255 Direct 95.0 0 983942 983942 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.16 94.96 0.00 0.00 1.3170 0.0000 93435769.27 93435769.27 0.00 1091255.27 1091255.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 94.96 100.00% 983942.09 786904 1246219 982509.17 909219 1049361 93435769 93435769 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 130160 10.4% 49.9 5.95sec 782189 0 Direct 49.8 0 784223 784223 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.92 49.79 0.00 0.00 0.0000 0.0000 39047696.69 39047696.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.79 100.00% 784223.45 627119 993167 783115.36 713571 845134 39047697 39047697 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14253 1.1% 70.7 3.99sec 60439 0 Direct 70.7 49152 100293 60438 22.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.75 70.75 0.00 0.00 0.0000 0.0000 4275918.41 4275918.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.13 77.93% 49151.94 47225 52501 49152.06 47682 50980 2709937 2709937 0.00
crit 15.61 22.07% 100292.97 96340 107103 100292.81 96340 107103 1565981 1565981 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 86908 (159081) 6.9% (12.7%) 73.0 4.01sec 653792 478872 Direct 73.0 257141 729382 357164 21.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.99 72.99 0.00 0.00 1.3653 0.0000 26071728.13 26071728.13 0.00 478872.33 478872.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.53 78.82% 257140.56 164717 604304 258430.02 205046 343471 14794298 14794298 0.00
crit 15.46 21.18% 729382.21 473069 1735560 732021.43 495041 1351711 11277430 11277430 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 72173 5.8% 70.0 5.31sec 309178 0 Direct 70.0 222455 632999 309167 21.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.03 70.03 0.00 0.00 0.0000 0.0000 21651251.58 21651251.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.24 78.88% 222455.24 138363 507615 223161.76 164114 323389 12288446 12288446 0.00
crit 14.79 21.12% 632999.27 397378 1457870 635029.71 411581 1229674 9362805 9362805 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31797 2.5% 16.1 18.53sec 591138 0 Direct 16.0 487076 993635 596767 21.7%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.14 15.98 0.00 0.00 0.0000 0.0000 9539050.69 9539050.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.52 78.34% 487076.02 487076 487076 487076.02 487076 487076 6099624 6099624 0.00
crit 3.46 21.66% 993635.07 993635 993635 966805.85 0 993635 3439427 3439427 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 248681 / 161483
Fire Blast 214435 11.1% 85.6 3.42sec 487898 236375 Direct 85.6 401232 802648 487893 21.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.62 85.62 0.00 0.00 2.0641 0.0000 41776143.27 41776143.27 0.00 236374.63 236374.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.14 78.41% 401232.33 382475 425211 401256.80 392102 413864 26937883 26937883 0.00
crit 18.49 21.59% 802647.74 764949 850423 802701.93 777277 839664 14838260 14838260 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34245 1.8% 10.0 31.25sec 664061 462977 Direct 10.0 118681 237550 144637 21.8%  
Periodic 100.7 42651 85192 51831 21.6% 67.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.04 10.04 100.65 100.65 1.4344 1.9989 6669646.42 6669646.42 0.00 30934.85 462976.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.85 78.16% 118680.83 113326 125989 118689.39 114300 125989 931708 931708 0.00
crit 2.19 21.84% 237550.25 226652 251977 217155.76 0 251977 520985 520985 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.9 78.42% 42651.09 14679 47246 42652.51 41394 44557 3366574 3366574 0.00
crit 21.7 21.58% 85191.59 29358 94491 85193.99 71041 91913 1850379 1850379 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182307 / 24309
Lightning Blast 182307 1.9% 37.0 7.04sec 197088 188630 Direct 37.0 163926 327968 197083 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7292262.40 7292262.40 0.00 188630.39 188630.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.52 79.78% 163925.90 157397 174984 163925.46 159291 171016 4839041 4839041 0.00
crit 7.48 20.22% 327967.69 314794 349968 327900.18 0 349968 2453221 2453221 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Tome
Ascendance 2.0 186.47sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 101.92sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.89 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.69sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.57sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.3sec 50.3sec 26.87% 46.21% 0.0(0.0) 5.6

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.21% 32.21% 3.0(3.0) 8.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.4 49.0 4.5sec 2.6sec 67.49% 72.16% 49.0(56.8) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.86%
  • elemental_focus_2:38.63%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 7.97% 23.52% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.97%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.2sec 17.1sec 29.97% 29.97% 4.3(4.3) 12.6

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.1sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.9sec 19.7sec 37.52% 34.11% 5.9(16.1) 0.7

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.23%
  • power_of_the_maelstrom_2:6.23%
  • power_of_the_maelstrom_3:25.06%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.1 0.0 18.3sec 18.3sec 16.06% 16.06% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.37% 11.31% 0.0(0.0) 0.2

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.22%
  • stormkeeper_2:3.09%
  • stormkeeper_3:4.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.59% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.7 83.6sec
Lava Surge: During Lava Burst 7.5 35.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6750.0019.2762.2560.00011.495
Fire Elemental0.4170.0011.4810.6000.0003.901
Ascendance6.2910.00170.1996.2150.00070.199
Lava Burst0.8180.00010.6685.4750.00025.711

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Tome
earth_shock Maelstrom 49.2 4957.3 100.8 100.8 17193.8
flame_shock Maelstrom 11.3 207.4 18.3 18.3 179061.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.15 1117.03 (21.39%) 11.74 24.83 2.17%
Lava Burst Overload Maelstrom 49.92 427.13 (8.18%) 8.56 22.12 4.92%
Lightning Bolt Maelstrom 73.00 583.99 (11.18%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 70.03 417.32 (7.99%) 5.96 2.86 0.68%
Aftershock Maelstrom 60.49 1549.44 (29.67%) 25.61 0.00 0.00%
Resonance Totem Maelstrom 298.59 290.97 (5.57%) 0.97 7.61 2.55%
The Deceiver's Blood Pact Maelstrom 9.80 835.64 (16.00%) 85.25 152.79 15.46%
Resource RPS-Gain RPS-Loss
Maelstrom 17.40 17.22
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 53.93 9.50 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Thurible + Tome Damage Per Second
Count 24999
Mean 1254216.25
Minimum 1025670.73
Maximum 1539550.93
Spread ( max - min ) 513880.20
Range [ ( max - min ) / 2 * 100% ] 20.49%
Standard Deviation 67711.1976
5th Percentile 1146402.05
95th Percentile 1368956.50
( 95th Percentile - 5th Percentile ) 222554.46
Mean Distribution
Standard Deviation 428.2518
95.00% Confidence Intervall ( 1253376.89 - 1255055.61 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11197
0.1 Scale Factor Error with Delta=300 39138544
0.05 Scale Factor Error with Delta=300 156554174
0.01 Scale Factor Error with Delta=300 3913854343
Priority Target DPS
Sample Data Thurible + Tome Priority Target Damage Per Second
Count 24999
Mean 1254216.25
Minimum 1025670.73
Maximum 1539550.93
Spread ( max - min ) 513880.20
Range [ ( max - min ) / 2 * 100% ] 20.49%
Standard Deviation 67711.1976
5th Percentile 1146402.05
95th Percentile 1368956.50
( 95th Percentile - 5th Percentile ) 222554.46
Mean Distribution
Standard Deviation 428.2518
95.00% Confidence Intervall ( 1253376.89 - 1255055.61 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11197
0.1 Scale Factor Error with Delta=300 39138544
0.05 Scale Factor Error with Delta=300 156554174
0.01 Scale Factor Error with Delta=300 3913854343
DPS(e)
Sample Data Thurible + Tome Damage Per Second (Effective)
Count 24999
Mean 1254216.25
Minimum 1025670.73
Maximum 1539550.93
Spread ( max - min ) 513880.20
Range [ ( max - min ) / 2 * 100% ] 20.49%
Damage
Sample Data Thurible + Tome Damage
Count 24999
Mean 320525204.94
Minimum 251950475.21
Maximum 405268302.27
Spread ( max - min ) 153317827.05
Range [ ( max - min ) / 2 * 100% ] 23.92%
DTPS
Sample Data Thurible + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.89 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.13 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.46 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 19.27 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.33 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.45 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.79 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 29.89 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.45 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 48.58 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHKKKFLLLIILLLLLILLLLLIILLLLLLILLLLLIIILLGLLNPPPLLIILLLAJKKIKLLLI97GLLLLLLNQQQQLNQQQNLLMQQNLQQQNOLQQQNQALJKKKMNLPPNPLLLIQQQLLNPPNLLLMNPQQLNQQQLNLLLL9HALLIJKKKLFLIILLLLLIILLLLIIIPPLNGPQOLNQQQQLNQQLNLQAMQQJLNQQQQLNPPPNLLLLLILLLMNP9PLNLLILLLLLIPPN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.105 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.245 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.099 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.955 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.793 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom bloodlust, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.631 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.631 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.748 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.3/125: 81% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:09.866 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.3/125: 91% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:10.704 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:11.543 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.220 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:14.338 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:15.479 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:16.617 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:17.474 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:18.329 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:19.468 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:20.324 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:21.180 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:22.320 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:23.459 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:24.314 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:25.169 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.310 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:27.148 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:27.986 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:29.103 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:29.941 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.058 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.896 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.013 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:34.130 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.247 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.364 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.483 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.339 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.195 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.051 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.169 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.621 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:43.711 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:44.800 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.251 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.363 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.843 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.325 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:51.777 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:53.230 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.3/125: 82% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:54.319 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.3/125: 99% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:55.408 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.496 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.977 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.459 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.941 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.941 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.052 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.141 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.231 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.321 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.410 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.500 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.952 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.063 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.175 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.286 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.286 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:13.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.6/125: 20% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:14.877 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:16.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:17.837 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:19.316 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:20.795 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.6/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:22.246 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.6/125: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:23.335 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:24.787 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.8/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:26.240 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.8/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:27.693 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.174 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:30.656 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.8/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:31.767 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:33.247 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.728 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.208 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.319 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:38.801 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.1/125: 34% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:39.915 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:41.025 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:42.504 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:43.984 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.1/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:45.094 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:46.574 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.056 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:49.536 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:51.017 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.2/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:52.128 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 24.9/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:52.881 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.9/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.335 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:55.786 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.239 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.691 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.802 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.283 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.283 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.764 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.875 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.985 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.096 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.3/125: 78% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.207 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.318 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.430 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.910 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:12.360 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:13.811 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:14.900 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:16.353 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:17.441 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:18.921 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.7/125: 75% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:20.032 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.7/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:21.143 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
2:22.623 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
2:24.103 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:25.583 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.9/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.9/125: 74% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.175 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.9/125: 86% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.286 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.768 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:32.218 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.7/125: 59% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:33.306 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.6/125: 39% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:35.485 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
2:36.937 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:38.050 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:39.161 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.643 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:42.094 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:43.545 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.6/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:44.998 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:46.088 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:47.539 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:48.992 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.473 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.954 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.4/125: 75% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.545 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.025 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.505 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.986 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 101.3/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.287 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.3/125: 90% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.398 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 99.3/125: 79% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.398 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.3/125: 79% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.879 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.3/125: 90% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.330 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.418 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.508 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.595 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.685 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:09.775 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.866 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:10.866 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:12.319 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:13.430 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, extracted_sanity
3:14.541 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, extracted_sanity
3:16.022 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:17.504 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
3:18.985 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
3:20.466 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
3:21.947 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:23.059 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:24.170 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:25.651 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.132 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.611 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.724 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.837 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.947 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.056 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.537 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.019 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.499 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.610 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.723 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.204 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:42.656 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:43.411 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:44.860 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:45.949 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:47.401 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.852 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.3/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:50.332 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.812 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:53.292 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:54.402 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:55.882 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.361 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.471 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.582 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.4/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.063 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.4/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.542 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.542 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.654 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.135 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.616 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.727 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.206 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.316 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.427 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.539 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.8/125: 44% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.651 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:15.133 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
4:16.613 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.8/125: 74% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:17.725 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:19.177 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, mark_of_the_claw
4:20.629 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, mark_of_the_claw
4:22.080 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:23.169 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:24.620 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:26.101 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.2/125: 58% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:27.580 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.2/125: 75% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.671 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.2/125: 87% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.122 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.2/125: 97% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.211 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.664 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.117 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.226 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.338 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.449 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.929 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.041 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.522 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.1/125: 46% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.002 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.1/125: 62% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.114 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.227 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:46.678 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:47.765 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.217 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.151 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.630 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.112 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.222 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.702 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.182 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Charm : 1296671 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1296671.1 1296671.1 968.9 / 0.075% 303230.4 / 23.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Charm 1296671
Earth Shock 297516 22.9% 52.7 5.53sec 1695027 1686808 Direct 52.7 1231837 3538086 1695023 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.66 52.66 0.00 0.00 1.0049 0.0000 89254046.55 89254046.55 0.00 1686807.52 1686807.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.08 79.91% 1231836.78 770237 1676408 1231454.85 1018461 1437685 51836667 51836667 0.00
crit 10.58 20.09% 3538086.22 2212121 4814645 3535769.60 0 4669826 37417379 37417379 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 136353 10.5% 11.3 27.14sec 3611398 3588630 Direct 11.3 93453 272116 226415 74.4%  
Periodic 227.1 51522 206004 168802 75.9% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 227.14 227.14 1.0064 1.3126 40906790.01 40906790.01 0.00 132146.66 3588629.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.90 25.58% 93453.26 83755 102083 92830.35 0 102083 270808 270808 0.00
crit 8.43 74.42% 272116.29 240544 293181 272169.88 259067 283948 2293765 2293765 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.7 24.08% 51522.40 187 56146 51532.72 47990 53633 2818197 2818197 0.00
crit 172.4 75.92% 206003.83 430 225754 206010.98 195515 213525 35524020 35524020 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 334694 (489709) 25.8% (37.8%) 102.3 2.91sec 1436026 1173405 Direct 102.1 0 983447 983447 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.30 102.10 0.00 0.00 1.2238 0.0000 100407243.83 100407243.83 0.00 1173404.94 1173404.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 102.10 100.00% 983446.66 793035 1177240 981895.58 908759 1047920 100407244 100407244 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 139836 10.8% 53.7 5.53sec 781837 0 Direct 53.5 0 783802 783802 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.66 53.52 0.00 0.00 0.0000 0.0000 41950252.41 41950252.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 53.52 100.00% 783801.93 632005 938195 782577.74 712002 846606 41950252 41950252 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 15180 1.2% 76.2 3.74sec 59797 0 Direct 76.2 49480 100938 59798 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.16 76.16 0.00 0.00 0.0000 0.0000 4553976.21 4553976.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.89 79.95% 49479.63 47593 52734 49480.05 48054 51686 3012630 3012630 0.00
crit 15.27 20.05% 100938.04 97090 107577 100942.77 97090 106501 1541346 1541346 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 90826 (165453) 7.0% (12.8%) 78.1 3.76sec 635198 496047 Direct 78.1 253162 729343 348705 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.14 78.14 0.00 0.00 1.2805 0.0000 27247541.29 27247541.29 0.00 496046.90 496046.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.46 79.94% 253162.00 166001 606980 254441.60 206855 370085 15813075 15813075 0.00
crit 15.68 20.06% 729342.60 476754 1743247 732935.33 495111 1582001 11434466 11434466 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 74627 5.8% 74.0 5.04sec 302531 0 Direct 74.0 219820 632703 302538 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.00 74.00 0.00 0.00 0.0000 0.0000 22387408.00 22387408.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.17 79.97% 219820.33 139441 509863 220548.17 162955 321555 13007382 13007382 0.00
crit 14.83 20.03% 632703.27 400474 1464328 635099.52 409921 1261492 9380026 9380026 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 266846 / 181903
Fire Blast 230968 12.1% 97.6 3.05sec 484238 253926 Direct 97.6 403366 806735 484237 20.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.55 97.55 0.00 0.00 1.9070 0.0000 47238148.90 47238148.90 0.00 253926.22 253926.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.99 79.95% 403365.92 385455 427095 403401.79 394756 415198 31459705 31459705 0.00
crit 19.56 20.05% 806734.76 770910 854190 806815.64 782441 840310 15778444 15778444 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 35879 1.9% 10.5 30.16sec 699966 512443 Direct 10.5 119343 238672 143241 20.0%  
Periodic 113.3 42861 85738 51465 20.1% 70.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.48 10.48 113.35 113.35 1.3660 1.8523 7334085.66 7334085.66 0.00 32703.93 512443.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.38 79.98% 119343.02 114209 126547 119352.87 115000 125598 1000134 1000134 0.00
crit 2.10 20.02% 238672.48 228418 253093 215565.07 0 253093 500602 500602 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.6 79.93% 42861.43 16 47455 42865.94 40943 44686 3883280 3883280 0.00
crit 22.7 20.07% 85737.78 40 94910 85748.51 63700 92314 1950069 1950069 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 193020 / 25738
Lightning Blast 193020 2.0% 39.0 6.68sec 198186 203709 Direct 39.0 164972 330001 198190 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.96 38.96 0.00 0.00 0.9729 0.0000 7720785.03 7720785.03 0.00 203709.27 203709.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.12 79.87% 164971.95 158623 175759 164968.51 160271 172701 5133341 5133341 0.00
crit 7.84 20.13% 330001.11 317247 351518 329984.89 0 351518 2587444 2587444 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Charm
Ascendance 2.0 184.86sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Charm
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 97.30sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 1.0574 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Charm
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Charm
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.61sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8531 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.75sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5080 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.0 0.0 49.2sec 49.2sec 27.94% 49.20% 0.0(0.0) 5.8

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 25.0sec 32.20% 32.20% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.2sec 69.2sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 68.2 54.0 4.4sec 2.4sec 66.76% 70.43% 54.0(61.6) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.52%
  • elemental_focus_2:38.24%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.9 0.8 13.2sec 12.7sec 8.14% 23.74% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.14%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.94% 29.94% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.5sec 69.5sec 13.52% 13.52% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.52%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.1sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.7 34.1sec 18.5sec 38.19% 32.89% 6.7(18.6) 0.6

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.02%
  • power_of_the_maelstrom_2:6.04%
  • power_of_the_maelstrom_3:26.13%

Trigger Attempt Success

  • trigger_pct:14.97%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.5sec 90.5sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 9.80% 10.56% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.01%
  • stormkeeper_2:2.92%
  • stormkeeper_3:3.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 99.07% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.7 12.7sec
Lava Surge: Wasted 0.8 83.7sec
Lava Surge: During Lava Burst 8.0 33.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6160.0006.2492.1330.0008.990
Fire Elemental0.3970.0011.7390.5880.0003.894
Ascendance5.4530.00274.1415.3410.00074.141
Lava Burst0.7760.0009.8565.1560.00021.412

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Charm
earth_shock Maelstrom 52.7 5297.7 100.6 100.6 16847.8
flame_shock Maelstrom 11.3 207.5 18.3 18.3 197099.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 102.31 1199.47 (21.57%) 11.72 28.20 2.30%
Lava Burst Overload Maelstrom 53.66 459.29 (8.26%) 8.56 23.63 4.89%
Lightning Bolt Maelstrom 78.14 625.11 (11.24%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 74.00 441.17 (7.93%) 5.96 2.81 0.63%
Aftershock Maelstrom 63.98 1651.56 (29.70%) 25.81 0.00 0.00%
Resonance Totem Maelstrom 298.59 291.02 (5.23%) 0.97 7.56 2.53%
The Deceiver's Blood Pact Maelstrom 10.51 893.76 (16.07%) 85.03 164.01 15.50%
Resource RPS-Gain RPS-Loss
Maelstrom 18.54 18.35
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 57.32 11.20 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Charm Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Whispers + Charm Damage Per Second
Count 24999
Mean 1296671.12
Minimum 1015734.35
Maximum 1620231.85
Spread ( max - min ) 604497.50
Range [ ( max - min ) / 2 * 100% ] 23.31%
Standard Deviation 78159.6702
5th Percentile 1170815.17
95th Percentile 1426702.15
( 95th Percentile - 5th Percentile ) 255886.98
Mean Distribution
Standard Deviation 494.3350
95.00% Confidence Intervall ( 1295702.25 - 1297640.00 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 140
0.1% Error 13958
0.1 Scale Factor Error with Delta=300 52149375
0.05 Scale Factor Error with Delta=300 208597499
0.01 Scale Factor Error with Delta=300 5214937468
Priority Target DPS
Sample Data Whispers + Charm Priority Target Damage Per Second
Count 24999
Mean 1296671.12
Minimum 1015734.35
Maximum 1620231.85
Spread ( max - min ) 604497.50
Range [ ( max - min ) / 2 * 100% ] 23.31%
Standard Deviation 78159.6702
5th Percentile 1170815.17
95th Percentile 1426702.15
( 95th Percentile - 5th Percentile ) 255886.98
Mean Distribution
Standard Deviation 494.3350
95.00% Confidence Intervall ( 1295702.25 - 1297640.00 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 140
0.1% Error 13958
0.1 Scale Factor Error with Delta=300 52149375
0.05 Scale Factor Error with Delta=300 208597499
0.01 Scale Factor Error with Delta=300 5214937468
DPS(e)
Sample Data Whispers + Charm Damage Per Second (Effective)
Count 24999
Mean 1296671.12
Minimum 1015734.35
Maximum 1620231.85
Spread ( max - min ) 604497.50
Range [ ( max - min ) / 2 * 100% ] 23.31%
Damage
Sample Data Whispers + Charm Damage
Count 24999
Mean 326707258.31
Minimum 248663568.90
Maximum 414682032.57
Spread ( max - min ) 166018463.67
Range [ ( max - min ) / 2 * 100% ] 25.41%
DTPS
Sample Data Whispers + Charm Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Charm Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Charm Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Charm Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Charm Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Charm Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + CharmTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Charm Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.97 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.48 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.73 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.35 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 102.61 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.79 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 31.93 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 19.16 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 52.99 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLQQLNQFLLLLLLLILLLLLILLLNIPPPNQLQMQNQQLLNILLLLLIIILLPJKKILLKLLMLLII97LPLLLILPNQAQLPMLNLLLLLLILLNNOPPPLLNIJQQLNIIQMQLQNNIQLQNIQQLLNQQQLLMNQQLQNQQQLLNPPPHNLAQJ9QNQQQLFLLLLILLLLLILLLMNPPPLNLLLLLLIL8LNQQQLNMPPJKLNNQQQLNNPPPLNQLNQLLAMQQNQLQQNNI9ILLLLLIIILQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Charm 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Charm 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Charm 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.955 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides
0:03.060 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
0:03.877 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
0:04.688 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:05.751 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
0:06.540 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
0:07.318 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.103 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.887 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.9/125: 18% maelstrom bloodlust, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
0:09.662 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:09.662 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:10.683 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:11.692 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.9/125: 50% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.701 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.9/125: 61% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:13.710 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:14.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.9/125: 82% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:15.729 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.9/125: 92% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:16.719 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.473 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.465 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.219 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.209 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:21.202 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.320 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.176 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.031 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.171 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.311 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.166 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.021 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.159 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.299 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.414 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.251 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.369 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.486 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.4/125: 53% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.605 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.443 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.581 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.435 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.7/125: 23% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.576 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.715 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.7/125: 42% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.570 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.050 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.7/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.140 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.9/125: 99% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.230 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.319 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.771 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.222 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.8/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.703 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.8/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.184 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.8/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.295 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.407 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.519 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.973 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.425 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
0:59.875 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.089 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.200 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.311 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.421 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom ascendance, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.900 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom ascendance, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.382 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.492 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.9/125: 70% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.973 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.9/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.454 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.9/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:12.543 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.9/125: 82% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:13.996 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.9/125: 92% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:15.085 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.174 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.264 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.376 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.376 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:19.858 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:21.340 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.453 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:23.563 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.674 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.782 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.261 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.743 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.853 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.5/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.334 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.334 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
1:32.795 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
1:34.237 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(3)
1:35.662 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(5)
1:36.705 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
1:37.737 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
1:38.756 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
1:40.098 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom ascendance, lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(9)
1:41.093 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.6/125: 53% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:42.405 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:43.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.6/125: 74% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:44.661 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.6/125: 84% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:45.949 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.6/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:46.918 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:48.206 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:49.493 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:50.458 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.9/125: 77% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:51.425 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:52.179 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.661 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.4/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.140 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.4/125: 44% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.621 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.101 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.212 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.4/125: 92% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.325 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.438 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.550 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.5/125: 32% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.662 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.773 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.253 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.342 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.4/125: 95% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.431 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.521 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.612 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.703 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.154 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.605 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:16.058 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.147 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:18.237 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.348 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.826 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:22.279 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:23.729 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:24.820 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.3/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:25.909 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.389 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.870 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.351 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.462 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.574 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.054 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.534 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.985 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.436 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.2/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:39.525 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.2/125: 75% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.613 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.2/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:41.701 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.182 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.665 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.147 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.626 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.736 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.216 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:51.666 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:53.117 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:54.125 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:54.884 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.8/125: 81% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:55.642 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
2:56.651 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:57.680 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:58.708 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.8/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:59.481 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.8/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:00.254 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:01.285 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:01.285 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, rising_tides
3:02.299 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, rising_tides(2)
3:03.302 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, rising_tides(3)
3:04.056 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.3/125: 50% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, rising_tides(3)
3:04.810 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, rising_tides(4)
3:05.566 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.4/125: 20% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, rising_tides(5)
3:06.793 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, rising_tides(6)
3:08.006 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, rising_tides(7)
3:09.601 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, rising_tides(9)
3:11.161 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, rising_tides(10)
3:11.161 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, rising_tides(10)
3:12.702 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, rising_tides(10)
3:14.244 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:15.556 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.4/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:16.868 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:17.854 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:19.163 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:20.474 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:21.785 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.235 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.685 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.775 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.227 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.710 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.821 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.932 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.044 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.525 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.977 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.427 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.879 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.1/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.4/125: 25% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.450 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.932 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.412 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.4/125: 64% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.893 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.4/125: 76% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.374 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.4/125: 93% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.853 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.077 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.832 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.313 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.404 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:54.855 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.307 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:57.758 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.4/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:59.211 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.4/125: 69% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.322 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.432 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.913 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.395 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.504 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.614 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.095 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.2/125: 67% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.206 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.4/125: 88% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.317 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.429 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.4/125: 40% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:12.518 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.421 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.511 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.7/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.621 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.101 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.582 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.063 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.543 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.656 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.134 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.8/125: 43% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.245 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.357 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.839 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.928 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.1/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.381 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.381 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides
4:33.458 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(2)
4:34.875 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.1/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(3)
4:36.273 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(4)
4:37.309 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.3/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
4:38.700 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:40.058 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(8)
4:41.377 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(9)
4:42.681 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:43.648 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.1/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:44.615 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:45.583 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:46.553 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:47.538 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:48.849 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:50.160 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:51.471 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:52.783 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.263 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.373 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.483 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.594 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.075 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 63178 60948 50720 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 63178 60948 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Charm"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=charm_of_the_rising_tide,id=147002,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=50720
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Sentinel : 1297275 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1297275.4 1297275.4 923.5 / 0.071% 291240.2 / 22.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Sentinel 1297275
Earth Shock 285965 22.0% 52.6 5.53sec 1629947 1586987 Direct 52.6 1184295 3399413 1629993 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.63 52.63 0.00 0.00 1.0271 0.0000 85789350.74 85789350.74 0.00 1586987.14 1586987.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.04 79.88% 1184295.31 735320 1607822 1183984.89 1005826 1364456 49792139 49792139 0.00
crit 10.59 20.12% 3399412.51 2111840 4617666 3397978.93 2157094 4437124 35997212 35997212 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 125454 9.7% 11.3 27.11sec 3322521 3263444 Direct 11.3 89268 260560 215354 73.6%  
Periodic 220.9 49210 197034 159334 74.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 220.91 220.91 1.0181 1.3497 37637298.88 37637298.88 0.00 121532.96 3263443.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.99 26.39% 89267.80 79958 97906 88860.36 0 97906 266877 266877 0.00
crit 8.34 73.61% 260559.60 229639 281187 260617.78 248241 271870 2172627 2172627 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.3 25.50% 49210.17 98 53849 49219.90 46373 51241 2772607 2772607 0.00
crit 164.6 74.50% 197034.45 132 216518 197045.09 186973 204251 32425188 32425188 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 309784 (471629) 23.9% (36.4%) 99.3 2.99sec 1425561 1126907 Direct 99.0 0 938363 938363 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.25 99.04 0.00 0.00 1.2650 0.0000 92934498.55 92934498.55 0.00 1126906.82 1126906.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 99.04 100.00% 938362.54 757085 1129076 936856.24 869109 998001 92934499 92934499 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 147780 11.4% 59.4 4.99sec 745814 0 Direct 59.3 0 747829 747829 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.44 59.28 0.00 0.00 0.0000 0.0000 44333838.87 44333838.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.28 100.00% 747828.75 603355 899811 746623.39 683397 805217 44333839 44333839 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14064 1.1% 73.8 3.82sec 57163 0 Direct 73.8 47310 96512 57165 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.81 73.81 0.00 0.00 0.0000 0.0000 4219321.45 4219321.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.03 79.97% 47309.92 45436 50577 47309.84 45436 49413 2792728 2792728 0.00
crit 14.78 20.03% 96512.47 92689 103176 96513.30 92689 103176 1426594 1426594 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 84610 (159933) 6.5% (12.3%) 75.5 3.90sec 635519 487763 Direct 75.5 244402 701949 336202 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.50 75.50 0.00 0.00 1.3029 0.0000 25382646.53 25382646.53 0.00 487762.64 487762.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.35 79.94% 244402.33 158476 582147 245688.46 199566 338374 14748626 14748626 0.00
crit 15.15 20.06% 701949.45 455142 1671927 704983.20 455142 1442635 10634020 10634020 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 75323 5.8% 77.6 4.88sec 291030 0 Direct 77.6 211497 608394 291038 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.64 77.64 0.00 0.00 0.0000 0.0000 22596612.88 22596612.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.08 79.96% 211496.71 133120 489004 212275.13 161092 319104 13130747 13130747 0.00
crit 15.56 20.04% 608394.36 382319 1404419 610740.91 394912 1222321 9465866 9465866 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (64864) 0.0% (5.0%) 3.0 120.42sec 6485999 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 324299.95 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 19893 1.5% 36.5 7.30sec 163656 0 Direct 36.5 135409 276235 163655 20.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.46 36.46 0.00 0.00 0.0000 0.0000 5967580.00 5967580.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.15 79.94% 135409.19 135409 135409 135409.19 135409 135409 3947173 3947173 0.00
crit 7.31 20.06% 276234.76 276235 276235 276190.56 0 276235 2020407 2020407 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
    Spectral Bolt 44971 3.5% 96.2 2.74sec 140301 0 Direct 96.2 116064 236771 140300 20.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.15 96.15 0.00 0.00 0.0000 0.0000 13490416.73 13490416.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.85 79.92% 116064.33 116064 116064 116064.33 116064 116064 8919185 8919185 0.00
crit 19.31 20.08% 236771.23 236771 236771 236771.23 236771 236771 4571231 4571231 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:90466.53
  • base_dd_max:99989.32
 
pet - primal_fire_elemental 246337 / 165064
Fire Blast 212807 11.0% 92.3 3.20sec 463512 234346 Direct 92.3 386032 772071 463514 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.30 92.30 0.00 0.00 1.9779 0.0000 42783173.34 42783173.34 0.00 234346.17 234346.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.78 79.93% 386032.02 367981 409621 386070.47 377417 396656 28480354 28480354 0.00
crit 18.53 20.07% 772071.11 735963 819242 772131.42 744148 808566 14302819 14302819 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 33531 1.7% 10.3 30.49sec 652470 467070 Direct 10.3 114179 228371 137166 20.1%  
Periodic 108.2 40971 81974 49200 20.1% 68.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.33 10.33 108.15 108.15 1.3970 1.9117 6737487.15 6737487.15 0.00 30462.11 467070.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.25 79.87% 114178.88 109031 121369 114188.34 109822 121369 941704 941704 0.00
crit 2.08 20.13% 228371.43 218063 242739 206117.19 0 242739 474666 474666 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.4 79.93% 40970.62 28 45513 40974.23 39318 42803 3541701 3541701 0.00
crit 21.7 20.07% 81974.50 64 91027 81977.61 66112 89056 1779415 1779415 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182732 / 24366
Lightning Blast 182732 1.9% 38.6 6.73sec 189512 190247 Direct 38.6 157797 315667 189513 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.57 38.57 0.00 0.00 0.9961 0.0000 7309294.15 7309294.15 0.00 190247.11 190247.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.82 79.91% 157797.12 151433 168568 157794.20 153207 165167 4863419 4863419 0.00
crit 7.75 20.09% 315666.53 302865 337137 315618.33 0 337137 2445875 2445875 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Sentinel
Ascendance 2.0 185.75sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 97.75sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 1.0775 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.60sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8595 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.81sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5088 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.0 0.0 48.9sec 48.9sec 28.04% 48.05% 0.0(0.0) 5.8

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:28.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.17% 32.17% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.2sec 69.2sec 8.66% 8.66% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.7 51.4 4.4sec 2.5sec 66.89% 70.86% 51.4(58.7) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.41%
  • elemental_focus_2:38.49%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.3 0.8 13.5sec 13.0sec 8.13% 23.71% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.13%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.91% 29.91% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.5sec 69.5sec 13.45% 13.45% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 84.2sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.3 34.3sec 18.9sec 38.15% 33.63% 6.3(17.5) 0.7

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.15%
  • power_of_the_maelstrom_2:6.12%
  • power_of_the_maelstrom_3:25.88%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 10.08% 10.93% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.10%
  • stormkeeper_2:3.02%
  • stormkeeper_3:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.48% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.1 13.0sec
Lava Surge: Wasted 0.8 83.5sec
Lava Surge: During Lava Burst 7.8 34.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6340.0007.1792.1770.00010.108
Fire Elemental0.4000.0011.7380.5840.0003.849
Ascendance6.0910.00174.3235.9800.00074.323
Lava Burst0.7920.0009.7155.2540.00020.694

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Sentinel
earth_shock Maelstrom 52.6 5318.1 101.0 101.0 16131.6
flame_shock Maelstrom 11.3 207.6 18.3 18.3 181336.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.25 1162.30 (20.82%) 11.71 28.76 2.41%
Lava Burst Overload Maelstrom 59.44 508.15 (9.10%) 8.55 26.83 5.02%
Lightning Bolt Maelstrom 75.49 603.96 (10.82%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 77.64 462.67 (8.29%) 5.96 3.18 0.68%
Aftershock Maelstrom 63.96 1657.70 (29.70%) 25.92 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.53 (5.20%) 0.97 8.04 2.69%
The Deceiver's Blood Pact Maelstrom 10.54 897.05 (16.07%) 85.15 167.21 15.71%
Resource RPS-Gain RPS-Loss
Maelstrom 18.61 18.42
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 57.53 12.20 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Whispers + Sentinel Damage Per Second
Count 24999
Mean 1297275.42
Minimum 1066830.18
Maximum 1630098.59
Spread ( max - min ) 563268.40
Range [ ( max - min ) / 2 * 100% ] 21.71%
Standard Deviation 74495.6421
5th Percentile 1178645.18
95th Percentile 1423837.22
( 95th Percentile - 5th Percentile ) 245192.04
Mean Distribution
Standard Deviation 471.1612
95.00% Confidence Intervall ( 1296351.96 - 1298198.87 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 127
0.1% Error 12668
0.1 Scale Factor Error with Delta=300 47374584
0.05 Scale Factor Error with Delta=300 189498334
0.01 Scale Factor Error with Delta=300 4737458350
Priority Target DPS
Sample Data Whispers + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1297275.42
Minimum 1066830.18
Maximum 1630098.59
Spread ( max - min ) 563268.40
Range [ ( max - min ) / 2 * 100% ] 21.71%
Standard Deviation 74495.6421
5th Percentile 1178645.18
95th Percentile 1423837.22
( 95th Percentile - 5th Percentile ) 245192.04
Mean Distribution
Standard Deviation 471.1612
95.00% Confidence Intervall ( 1296351.96 - 1298198.87 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 127
0.1% Error 12668
0.1 Scale Factor Error with Delta=300 47374584
0.05 Scale Factor Error with Delta=300 189498334
0.01 Scale Factor Error with Delta=300 4737458350
DPS(e)
Sample Data Whispers + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1297275.42
Minimum 1066830.18
Maximum 1630098.59
Spread ( max - min ) 563268.40
Range [ ( max - min ) / 2 * 100% ] 21.71%
Damage
Sample Data Whispers + Sentinel Damage
Count 24999
Mean 332351564.63
Minimum 266392992.98
Maximum 421016549.12
Spread ( max - min ) 154623556.14
Range [ ( max - min ) / 2 * 100% ] 23.26%
DTPS
Sample Data Whispers + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.52 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 21.07 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.40 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 99.55 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.73 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 31.56 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.83 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 50.62 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHKKKFLLLILLLLLILLLLILLLLLILLLLNMPPPNQLQNQQLLNIQQQLLJKIKKLLMNQQQLNIQQQLNQ97QLQLNIQQLNMQQQLNNOQQLNQQQAJLLMNQQQLNQLQNQLQQNQLLNLPPLNMPQQLLNILLLLLILLLHLLIJKKKLL9ILLFLLIILLLLLLILLLMNIQLPPNIOPLLNLLLLLLILLALJKIKGKLLLIQLNQLLQNQQLNMQQQQLLN9LPNLILLLLILLNM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.965 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.105 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.245 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.100 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.955 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.813 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.669 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.669 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.660 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.3/125: 84% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.799 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.656 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.796 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.7/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.936 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.7/125: 57% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.077 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.7/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.216 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.7/125: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.356 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.211 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.206 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.345 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.485 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.342 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.481 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.620 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.759 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.6/125: 68% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.899 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.6/125: 85% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.039 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.6/125: 96% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.894 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.750 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.891 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.029 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.6/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.167 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.6/125: 86% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.023 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.878 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.7/125: 23% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.017 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.157 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.295 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.150 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.290 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.771 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.253 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.9/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.366 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.847 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.328 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.439 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.921 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.033 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.1/125: 98% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.145 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.626 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.076 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.527 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.617 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.7/125: 73% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:00.067 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 104.7/125: 84% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.177 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 114.7/125: 92% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.288 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.400 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.510 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.621 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.733 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.212 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.324 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.436 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.917 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.398 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.877 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.357 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.467 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.6/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.579 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.059 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.540 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.020 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.499 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.614 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.093 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.206 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:28.206 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.686 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.165 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.646 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.758 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.3/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.870 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.982 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.462 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:38.941 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:40.392 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:41.482 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:42.571 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.4/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:44.020 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:45.473 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.4/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:46.924 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:48.376 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:49.466 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.4/125: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:50.554 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 31.7/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:51.308 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.7/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:52.760 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.240 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.720 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.833 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.315 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.795 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.277 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.277 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.388 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.499 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.979 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.090 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.202 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.290 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.379 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.8/125: 47% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.468 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.8/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.922 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.011 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.461 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.571 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.052 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.163 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.643 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.123 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.604 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.082 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.194 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.675 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.9/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.157 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.9/125: 44% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.269 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.378 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.488 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.939 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.390 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.842 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.7/125: 76% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.931 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.044 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.9/125: 21% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.525 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.9/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.006 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.486 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.9/125: 53% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.597 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.9/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.076 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.9/125: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.165 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.255 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.346 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.798 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.250 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.702 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.155 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.244 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.696 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
2:57.705 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:58.734 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:59.508 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:00.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:01.566 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:02.341 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:03.158 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:03.928 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:04.702 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:05.474 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:06.233 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:06.991 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:07.851 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:09.133 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:10.413 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:12.119 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:12.119 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:13.859 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:15.600 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.712 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.823 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.304 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.782 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.264 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.714 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.164 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.615 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.705 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.793 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:30.244 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:31.334 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.445 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.556 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.8/125: 97% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.667 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.148 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.628 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.108 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.589 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.8/125: 73% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.701 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:42.813 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.568 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:45.048 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:46.500 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:47.589 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.678 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:50.130 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:51.582 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.061 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.542 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.021 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.502 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.592 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.043 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.494 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.494 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.945 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.242 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.354 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.467 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.578 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.689 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.800 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.912 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.024 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.506 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.616 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.098 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.210 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.323 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.805 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.916 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.396 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.848 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.938 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.391 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.843 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.322 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.435 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.7/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.549 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.7/125: 15% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.028 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.7/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.480 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.933 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:37.384 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.475 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.928 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.7/125: 89% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.040 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:42.205 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.317 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.798 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.910 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.2/125: 90% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.391 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.503 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.982 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.462 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.422 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.535 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.648 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.130 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.243 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60314 58083 47992 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60314 58083 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=47992
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Terror : 1287387 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1287386.8 1287386.8 941.3 / 0.073% 295130.8 / 22.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Terror 1287387
Earth Shock 290487 22.6% 51.4 5.64sec 1695259 1650515 Direct 51.4 1179546 3385285 1695263 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.41 51.41 0.00 0.00 1.0271 0.0000 87145550.27 87145550.27 0.00 1650515.17 1650515.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.39 76.62% 1179545.96 735320 1607822 1179139.57 997588 1362279 46458719 46458719 0.00
crit 12.02 23.38% 3385285.46 2111840 4617666 3384140.92 2463494 4381448 40686832 40686832 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 127241 9.9% 11.3 27.13sec 3366940 3307066 Direct 11.3 89319 260516 218201 75.3%  
Periodic 220.9 49245 196479 161588 76.3% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.34 11.34 220.93 220.93 1.0181 1.3496 38173466.08 38173466.08 0.00 123259.50 3307066.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.80 24.71% 89319.03 79958 97906 88639.65 0 97906 250281 250281 0.00
crit 8.54 75.29% 260516.19 229639 281187 260570.94 247618 272429 2223672 2223672 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.4 23.70% 49244.59 236 53849 49253.84 45721 51301 2578142 2578142 0.00
crit 168.6 76.30% 196479.42 395 216518 196486.50 186344 204011 33121372 33121372 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 314082 (459820) 24.4% (35.7%) 99.1 3.00sec 1392442 1100996 Direct 98.9 0 953104 953104 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.07 98.86 0.00 0.00 1.2647 0.0000 94223964.94 94223964.94 0.00 1100996.49 1100996.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.86 100.00% 953104.02 757085 1159668 951442.00 883459 1024389 94223965 94223965 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 131282 10.2% 52.0 5.66sec 757530 0 Direct 51.9 0 759528 759528 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.99 51.85 0.00 0.00 0.0000 0.0000 39384135.18 39384135.18 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.85 100.00% 759528.24 603355 924191 758193.38 683709 824143 39384135 39384135 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14456 1.1% 73.8 3.81sec 58787 0 Direct 73.8 47312 96515 58786 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.77 73.77 0.00 0.00 0.0000 0.0000 4336851.26 4336851.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.57 76.68% 47312.47 45436 50577 47313.28 45782 49235 2676397 2676397 0.00
crit 17.20 23.32% 96514.61 92689 103176 96512.09 0 102504 1660455 1660455 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 89589 (163442) 7.0% (12.7%) 76.6 3.82sec 640059 491061 Direct 76.6 243905 701662 350848 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.61 76.61 0.00 0.00 1.3034 0.0000 26876423.95 26876423.95 0.00 491060.53 491060.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.71 76.64% 243904.82 158476 582147 245168.04 196152 339599 14319329 14319329 0.00
crit 17.90 23.36% 701661.71 455142 1671927 704818.11 481124 1494418 12557095 12557095 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73852 5.7% 72.8 5.11sec 304446 0 Direct 72.8 211586 609077 304436 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.77 72.77 0.00 0.00 0.0000 0.0000 22155479.00 22155479.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.77 76.64% 211586.10 133120 489004 212307.18 155563 316738 11800778 11800778 0.00
crit 17.00 23.36% 609077.47 382319 1404419 611086.37 388691 1188582 10354701 10354701 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 49379 3.8% 9.7 29.35sec 1534573 0 Direct 9.7 1233906 2517168 1534639 23.4%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.65 9.65 0.00 0.00 0.0000 0.0000 14813514.21 14813514.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.39 76.57% 1233905.72 1233906 1233906 1233757.64 0 1233906 9120359 9120359 0.00
crit 2.26 23.43% 2517167.67 2517168 2517168 2281551.35 0 2517168 5693155 5693155 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 252877 / 171996
Fire Blast 218514 11.5% 93.7 3.17sec 476070 240566 Direct 93.7 385886 771752 476065 23.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.67 93.67 0.00 0.00 1.9790 0.0000 44591489.81 44591489.81 0.00 240565.65 240565.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.77 76.63% 385886.33 367981 409621 385920.07 377915 397521 27696784 27696784 0.00
crit 21.89 23.37% 771751.58 735963 819242 771827.31 749357 804952 16894705 16894705 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34362 1.8% 10.5 30.18sec 669914 479417 Direct 10.5 114162 228360 140887 23.4%  
Periodic 109.5 40966 81910 50536 23.4% 69.8%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.46 10.46 109.52 109.52 1.3974 1.9124 7008595.88 7008595.88 0.00 31279.02 479416.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.01 76.60% 114162.05 109031 121369 114174.22 109981 121369 914855 914855 0.00
crit 2.45 23.40% 228360.20 218063 242739 213630.86 0 242739 559088 559088 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.9 76.63% 40965.84 20 45513 40969.43 39316 42969 3437917 3437917 0.00
crit 25.6 23.37% 81910.21 63 91027 81915.62 68909 88259 2096737 2096737 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 187662 / 25023
Lightning Blast 187662 1.9% 38.5 6.76sec 194736 195359 Direct 38.5 157823 315695 194733 23.4%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.55 38.55 0.00 0.00 0.9968 0.0000 7506478.77 7506478.77 0.00 195359.12 195359.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.53 76.62% 157823.46 151433 168568 157823.47 153080 164953 4661181 4661181 0.00
crit 9.01 23.38% 315694.92 302865 337137 315692.02 0 337137 2845298 2845298 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Terror
Ascendance 2.0 186.10sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 96.50sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 1.0767 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8594 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.69sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5089 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.4sec 49.4sec 27.55% 47.77% 0.0(0.0) 5.7

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.0sec 32.19% 32.19% 3.0(3.0) 8.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.3sec 69.3sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 68.4 54.0 4.4sec 2.4sec 68.78% 72.32% 54.0(62.2) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.66%
  • elemental_focus_2:40.13%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.3 0.8 13.5sec 13.0sec 8.08% 23.74% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.08%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.0sec 17.0sec 30.02% 30.02% 4.3(4.3) 12.6

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.6sec 69.6sec 13.47% 13.47% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.47%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.5sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.3 34.3sec 18.9sec 37.89% 33.25% 6.3(17.5) 0.6

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.14%
  • power_of_the_maelstrom_2:6.13%
  • power_of_the_maelstrom_3:25.62%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 10.01% 10.77% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.08%
  • stormkeeper_2:3.00%
  • stormkeeper_3:3.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.62% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.1 13.0sec
Lava Surge: Wasted 0.8 84.2sec
Lava Surge: During Lava Burst 7.8 34.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6310.0006.7182.1700.0009.564
Fire Elemental0.4240.0011.7380.6440.0003.765
Ascendance5.9830.00278.0435.8820.00078.043
Lava Burst0.7980.00010.2735.2960.00021.344

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Terror
earth_shock Maelstrom 51.4 5168.3 100.5 100.5 16861.6
flame_shock Maelstrom 11.3 207.8 18.3 18.3 183743.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.07 1162.23 (21.39%) 11.73 26.56 2.23%
Lava Burst Overload Maelstrom 51.99 445.09 (8.19%) 8.56 22.81 4.87%
Lightning Bolt Maelstrom 76.61 612.85 (11.28%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 72.78 433.75 (7.98%) 5.96 2.90 0.66%
Aftershock Maelstrom 62.74 1612.81 (29.69%) 25.70 0.00 0.00%
Resonance Totem Maelstrom 298.58 291.00 (5.36%) 0.97 7.58 2.54%
The Deceiver's Blood Pact Maelstrom 10.28 874.62 (16.10%) 85.07 159.23 15.40%
Resource RPS-Gain RPS-Loss
Maelstrom 18.11 17.92
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.88 12.40 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Whispers + Terror Damage Per Second
Count 24999
Mean 1287386.76
Minimum 1044822.28
Maximum 1600324.96
Spread ( max - min ) 555502.68
Range [ ( max - min ) / 2 * 100% ] 21.57%
Standard Deviation 75935.6084
5th Percentile 1166191.07
95th Percentile 1415969.09
( 95th Percentile - 5th Percentile ) 249778.02
Mean Distribution
Standard Deviation 480.2686
95.00% Confidence Intervall ( 1286445.45 - 1288328.07 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 134
0.1% Error 13366
0.1 Scale Factor Error with Delta=300 49223742
0.05 Scale Factor Error with Delta=300 196894967
0.01 Scale Factor Error with Delta=300 4922374165
Priority Target DPS
Sample Data Whispers + Terror Priority Target Damage Per Second
Count 24999
Mean 1287386.76
Minimum 1044822.28
Maximum 1600324.96
Spread ( max - min ) 555502.68
Range [ ( max - min ) / 2 * 100% ] 21.57%
Standard Deviation 75935.6084
5th Percentile 1166191.07
95th Percentile 1415969.09
( 95th Percentile - 5th Percentile ) 249778.02
Mean Distribution
Standard Deviation 480.2686
95.00% Confidence Intervall ( 1286445.45 - 1288328.07 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 134
0.1% Error 13366
0.1 Scale Factor Error with Delta=300 49223742
0.05 Scale Factor Error with Delta=300 196894967
0.01 Scale Factor Error with Delta=300 4922374165
DPS(e)
Sample Data Whispers + Terror Damage Per Second (Effective)
Count 24999
Mean 1287386.76
Minimum 1044822.28
Maximum 1600324.96
Spread ( max - min ) 555502.68
Range [ ( max - min ) / 2 * 100% ] 21.57%
Damage
Sample Data Whispers + Terror Damage
Count 24999
Mean 327109384.89
Minimum 261980652.82
Maximum 415388250.74
Spread ( max - min ) 153407597.92
Range [ ( max - min ) / 2 * 100% ] 23.45%
DTPS
Sample Data Whispers + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.97 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 20.03 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 99.36 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.80 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 31.38 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.96 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 51.68 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGKPPPEKKKHKKKKKHKKKKHKOMMOOPKMHHOOOLKMPPPKMHKPPMPPPPKMPIPMKKHJJMLKMOPMMKPPK97MKOOMOPKKLMKKKKKKHHKKNOMOOIKJHJJKKLMOOOKKMPPPKKHKKMOKOLOMPKPPMMPKPMMPPGKPMIPKPP9EKKKHKKKKHKKKKMKKKKKHFKKOMOOPMNPKPMPPPKKLMPPKIMPKPKJMOOPKMPPPMKKKLMMPKKMPPPKKMHHP9KPMPPP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.968 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.088 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.926 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.765 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.881 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.718 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.555 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom bloodlust, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.411 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.411 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.550 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.689 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.826 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.683 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.822 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.961 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.098 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.236 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.376 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.233 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.371 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.510 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.648 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.1/125: 83% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.787 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.643 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.782 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.922 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.778 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.9/125: 92% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.633 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.772 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.1/125: 36% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.912 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.052 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.1/125: 70% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.191 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.1/125: 86% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.046 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.902 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.756 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.896 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.035 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.174 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.029 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.167 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.280 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.760 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:45.211 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:46.220 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:46.980 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:47.738 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:48.496 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:49.506 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:50.515 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:51.543 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.4/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:52.317 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:53.344 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:54.375 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:55.403 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:56.433 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:57.463 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.6/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:58.769 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:00.510 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:01.817 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:03.124 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:04.429 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.8/125: 75% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
1:06.170 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.8/125: 86% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.281 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.8/125: 97% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.392 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.503 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.8/125: 42% maelstrom stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.615 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.728 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.842 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.323 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.434 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.884 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.335 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.425 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.8/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.514 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.968 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.448 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.927 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.040 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.151 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 97.4/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.151 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.4/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.261 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.5/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.743 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.223 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.704 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.815 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.296 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.777 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.888 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.6/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:39.370 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.6/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:40.460 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:41.551 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.7/125: 22% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:43.003 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:44.451 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:45.902 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.7/125: 69% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:47.383 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.7/125: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.863 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.7/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:50.315 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:51.405 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:52.495 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:53.947 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:55.396 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.151 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.634 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.746 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.229 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.711 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.925 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.037 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.148 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.259 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.368 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.479 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.591 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.073 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.9/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.184 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.297 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.2/125: 21% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.777 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.259 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.740 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.852 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.2/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.333 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.2/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.444 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.925 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.405 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.886 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.997 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.477 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.587 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.698 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.787 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.877 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.1/125: 18% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.328 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.1/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.779 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.1/125: 42% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.231 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.321 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.1/125: 55% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:39.773 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.1/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.883 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.365 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.846 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.326 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.8/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.804 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.8/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.917 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.027 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.508 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.987 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:53.441 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.530 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.9/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.620 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.070 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.521 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.632 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.112 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.592 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.701 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 22.6/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.814 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.925 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.405 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.6/125: 42% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.517 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.629 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.742 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.742 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.222 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.702 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.6/125: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.182 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.6/125: 94% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.294 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.407 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.888 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.7/125: 65% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.998 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.7/125: 83% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.478 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.7/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.590 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.071 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.555 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.037 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.8/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.518 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.8/125: 87% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.629 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.110 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.590 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.071 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.2/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.552 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.2/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:36.581 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:37.339 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:38.096 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:39.105 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:40.116 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:41.126 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:41.884 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:42.895 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:43.924 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.6/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:44.954 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:45.727 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:46.483 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:47.511 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:48.541 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.7/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:50.279 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:51.585 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:53.326 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:55.066 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:56.807 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.9/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.285 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.9/125: 68% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:59.373 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.9/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.462 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.9/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.551 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.1/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.003 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.453 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.934 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.046 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.1/125: 61% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.156 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.267 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.378 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.490 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.9/125: 61% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.971 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.9/125: 72% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.083 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.9/125: 84% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.194 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.1/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.674 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.1/125: 34% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.155 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.1/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.636 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.114 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.1/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.226 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.706 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.186 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.666 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.756 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.2/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.846 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.298 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.386 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.478 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.567 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.8/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:34.655 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:36.107 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:37.556 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:38.645 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.9/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.733 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:41.186 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:42.635 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:44.086 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.196 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.676 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.788 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.899 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.011 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.491 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.604 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.084 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.536 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.625 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.076 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:59.085 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60314 58083 47992 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60314 58083 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=47992
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Thurible : 1263830 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1263829.6 1263829.6 941.6 / 0.075% 294641.4 / 23.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Thurible 1263830
Earth Shock 284911 22.5% 51.4 5.69sec 1662933 1618917 Direct 51.4 1209168 3470613 1662971 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.40 51.40 0.00 0.00 1.0272 0.0000 85472365.62 85472365.62 0.00 1618917.45 1618917.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.09 79.93% 1209167.85 754685 1650164 1208772.52 1019514 1395215 49678380 49678380 0.00
crit 10.31 20.07% 3470613.03 2167455 4739271 3469700.23 2380092 4587614 35793985 35793985 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 128678 10.2% 11.3 27.11sec 3407176 3345260 Direct 11.3 91573 267449 220919 73.5%  
Periodic 220.9 50499 202208 163404 74.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 220.93 220.93 1.0186 1.3495 38604299.95 38604299.95 0.00 124651.84 3345259.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.00 26.45% 91572.85 82064 100485 91161.29 0 100485 274459 274459 0.00
crit 8.33 73.55% 267449.03 235687 288592 267506.48 255309 279276 2228678 2228678 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.5 25.58% 50498.58 101 55268 50509.65 47316 52516 2853617 2853617 0.00
crit 164.4 74.42% 202208.18 783 222220 202219.53 191143 209916 33247547 33247547 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 317167 (464253) 25.1% (36.7%) 99.1 3.00sec 1406025 1111881 Direct 98.8 0 962575 962575 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.06 98.85 0.00 0.00 1.2646 0.0000 95149770.70 95149770.70 0.00 1111881.01 1111881.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.85 100.00% 962574.98 777023 1158810 960983.01 893046 1024707 95149771 95149771 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 132678 10.5% 52.0 5.68sec 765151 0 Direct 51.9 0 767169 767169 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.02 51.88 0.00 0.00 0.0000 0.0000 39803109.12 39803109.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.88 100.00% 767168.87 619244 923507 765906.44 698006 831114 39803109 39803109 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14408 1.1% 73.6 3.80sec 58689 0 Direct 73.6 48560 99062 58689 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.65 73.65 0.00 0.00 0.0000 0.0000 4322447.33 4322447.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.88 79.94% 48559.80 46632 51909 48559.90 46959 50703 2859095 2859095 0.00
crit 14.77 20.06% 99062.12 95130 105893 99061.29 95130 105893 1463352 1463352 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 87840 (160232) 7.0% (12.7%) 76.6 3.85sec 627132 481087 Direct 76.6 249763 718611 343806 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.65 76.65 0.00 0.00 1.3036 0.0000 26351502.96 26351502.96 0.00 481086.70 481086.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.27 79.94% 249763.30 162649 597478 251076.48 202598 355946 15303819 15303819 0.00
crit 15.37 20.06% 718611.38 467128 1715957 721870.07 491109 1342846 11047684 11047684 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 72392 5.7% 72.8 5.14sec 298477 0 Direct 72.8 216879 623330 298476 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.76 72.76 0.00 0.00 0.0000 0.0000 21717237.10 21717237.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.15 79.92% 216879.37 136625 501882 217613.30 158121 343893 12612098 12612098 0.00
crit 14.61 20.08% 623330.32 392388 1441404 625694.41 399219 1317100 9105139 9105139 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31525 2.5% 16.2 18.06sec 583631 0 Direct 16.1 487076 993635 589237 20.2%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.20 16.05 0.00 0.00 0.0000 0.0000 9457340.23 9457340.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.81 79.83% 487076.02 487076 487076 487076.02 487076 487076 6241252 6241252 0.00
crit 3.24 20.17% 993635.07 993635 993635 960247.60 0 993635 3216088 3216088 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 252874 / 169227
Fire Blast 218448 11.6% 92.2 3.20sec 475639 240557 Direct 92.2 396196 792341 475638 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.22 92.22 0.00 0.00 1.9773 0.0000 43861176.47 43861176.47 0.00 240556.66 240556.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.72 79.95% 396196.35 377672 420408 396233.43 387876 408283 29208525 29208525 0.00
crit 18.49 20.05% 792341.45 755344 840817 792413.40 761321 830955 14652652 14652652 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34426 1.8% 10.3 30.55sec 669663 479453 Direct 10.3 117199 234416 140862 20.2%  
Periodic 108.1 42050 84114 50480 20.0% 68.8%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.32 10.32 108.07 108.07 1.3968 1.9111 6908437.20 6908437.20 0.00 31269.52 479452.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.23 79.81% 117198.83 111903 124565 117206.95 111903 124565 964931 964931 0.00
crit 2.08 20.19% 234416.02 223806 249131 211227.52 0 249131 488291 488291 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.4 79.96% 42049.56 20 46712 42053.24 40135 44169 3633424 3633424 0.00
crit 21.7 20.04% 84114.28 64 93424 84116.04 69753 91135 1821791 1821791 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 187519 / 25004
Lightning Blast 187519 2.0% 38.6 6.76sec 194475 195225 Direct 38.6 161940 324013 194479 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.57 38.57 0.00 0.00 0.9962 0.0000 7500757.96 7500757.96 0.00 195225.47 195225.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.83 79.92% 161939.98 155421 173008 161939.89 157174 169265 4991984 4991984 0.00
crit 7.74 20.08% 324013.22 310841 346015 323931.18 0 346015 2508774 2508774 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Thurible
Ascendance 2.0 186.19sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Thurible
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 98.16sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 0.00 0.00 0.00 1.0775 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Thurible
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Thurible
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.61sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8589 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.74sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5088 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.4sec 49.4sec 27.59% 47.77% 0.0(0.0) 5.7

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 25.0sec 32.13% 32.13% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.3sec 69.3sec 8.67% 8.67% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.67%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.3 51.6 4.5sec 2.5sec 66.87% 70.66% 51.6(58.9) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.37%
  • elemental_focus_2:38.50%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.3 0.8 13.5sec 13.0sec 8.09% 23.73% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.09%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.98% 29.98% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.7sec 69.7sec 13.48% 13.48% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.48%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 84.2sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.3sec 19.0sec 37.76% 33.14% 6.3(17.4) 0.6

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.11%
  • power_of_the_maelstrom_2:6.08%
  • power_of_the_maelstrom_3:25.58%

Trigger Attempt Success

  • trigger_pct:14.97%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.2sec 18.2sec 16.13% 16.13% 0.0(0.0) 16.1

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 9.98% 10.77% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.08%
  • stormkeeper_2:2.98%
  • stormkeeper_3:3.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.57% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.1 13.0sec
Lava Surge: Wasted 0.8 84.1sec
Lava Surge: During Lava Burst 7.8 34.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6300.0007.3082.1680.00013.659
Fire Elemental0.4000.0011.7360.5840.0003.849
Ascendance6.0100.00167.8705.9000.00067.870
Lava Burst0.7980.00010.5845.3050.00021.916

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Thurible
earth_shock Maelstrom 51.4 5168.0 100.5 100.5 16538.9
flame_shock Maelstrom 11.3 207.6 18.3 18.3 185950.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.06 1162.09 (21.39%) 11.73 26.61 2.24%
Lava Burst Overload Maelstrom 52.02 445.55 (8.20%) 8.56 22.64 4.84%
Lightning Bolt Maelstrom 76.64 613.16 (11.29%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 72.76 433.67 (7.98%) 5.96 2.88 0.66%
Aftershock Maelstrom 62.73 1612.67 (29.69%) 25.71 0.00 0.00%
Resonance Totem Maelstrom 298.58 291.02 (5.36%) 0.97 7.56 2.53%
The Deceiver's Blood Pact Maelstrom 10.27 873.62 (16.08%) 85.05 159.08 15.40%
Resource RPS-Gain RPS-Loss
Maelstrom 18.11 17.92
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.89 9.20 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Thurible Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Whispers + Thurible Damage Per Second
Count 24999
Mean 1263829.63
Minimum 1025379.99
Maximum 1572900.96
Spread ( max - min ) 547520.96
Range [ ( max - min ) / 2 * 100% ] 21.66%
Standard Deviation 75958.3203
5th Percentile 1143623.76
95th Percentile 1394140.97
( 95th Percentile - 5th Percentile ) 250517.21
Mean Distribution
Standard Deviation 480.4122
95.00% Confidence Intervall ( 1262888.04 - 1264771.22 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 139
0.1% Error 13877
0.1 Scale Factor Error with Delta=300 49253192
0.05 Scale Factor Error with Delta=300 197012765
0.01 Scale Factor Error with Delta=300 4925319113
Priority Target DPS
Sample Data Whispers + Thurible Priority Target Damage Per Second
Count 24999
Mean 1263829.63
Minimum 1025379.99
Maximum 1572900.96
Spread ( max - min ) 547520.96
Range [ ( max - min ) / 2 * 100% ] 21.66%
Standard Deviation 75958.3203
5th Percentile 1143623.76
95th Percentile 1394140.97
( 95th Percentile - 5th Percentile ) 250517.21
Mean Distribution
Standard Deviation 480.4122
95.00% Confidence Intervall ( 1262888.04 - 1264771.22 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 139
0.1% Error 13877
0.1 Scale Factor Error with Delta=300 49253192
0.05 Scale Factor Error with Delta=300 197012765
0.01 Scale Factor Error with Delta=300 4925319113
DPS(e)
Sample Data Whispers + Thurible Damage Per Second (Effective)
Count 24999
Mean 1263829.63
Minimum 1025379.99
Maximum 1572900.96
Spread ( max - min ) 547520.96
Range [ ( max - min ) / 2 * 100% ] 21.66%
Damage
Sample Data Whispers + Thurible Damage
Count 24999
Mean 320878073.00
Minimum 256182329.62
Maximum 401573815.67
Spread ( max - min ) 145391486.05
Range [ ( max - min ) / 2 * 100% ] 22.66%
DTPS
Sample Data Whispers + Thurible Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Thurible Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Thurible Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Thurible Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Thurible Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Thurible Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + ThuribleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Thurible Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.94 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.48 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 20.04 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.36 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 99.35 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.78 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 31.36 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.86 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 51.79 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGPKPPEKKKHKKKKKHKKKKKHKKKKKKHKKKKHHLKOOOKMPPPPKMHHPPIKKJHHHHJJKFMMKK97KKKHKKMPKPMMKKKKKKHKFKKKMONOKKMOOOIKKLKMHPKKJJHOPKMPPPMKMPPPMKKLPPMKPPPKMKPP9MPGKPIPPKKMHHPEKKKKKHHKKKKKKHKKKKFKHKKKKK8HHKKMMOOOKMHILKPKKMPPPPMKHPPKMPPPKMPL9KKPMPPPKMPPPKMPPKPKM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.964 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:03.106 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:04.246 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.102 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.957 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.811 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.668 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom bloodlust, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.523 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.523 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.663 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom bloodlust, ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.518 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.3/125: 87% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.658 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.3/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.515 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.655 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.795 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.933 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.9/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.072 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.9/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.211 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.066 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.206 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.062 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.201 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.055 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.911 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.767 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.906 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.045 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.185 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.324 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.463 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.5/125: 91% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.602 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.441 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.281 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:34.119 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:35.235 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:36.353 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.192 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.030 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.886 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.5/125: 20% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:39.742 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:40.883 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:42.022 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.503 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.981 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:46.094 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.9/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.575 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.055 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.536 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.016 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.496 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.9/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.607 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.718 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.829 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.310 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.791 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.110 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.220 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.704 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:04.816 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:05.928 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.040 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.152 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.264 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.354 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:11.442 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:12.893 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
1:13.981 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
1:15.070 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.7/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
1:16.161 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.613 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.064 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 67.1/125: 54% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.153 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 68.1/125: 54% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.153 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.1/125: 54% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:21.606 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:23.057 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.1/125: 83% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.508 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.597 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.050 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.530 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.641 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:31.094 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.187 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:33.197 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:33.954 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:34.712 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:35.722 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:36.731 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:37.742 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:38.752 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.8/125: 73% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:39.761 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.8/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
1:40.770 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.8/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:41.530 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:42.539 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
1:43.314 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
1:44.343 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:45.650 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:47.390 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.9/125: 69% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, spear_of_anguish, potion_of_prolonged_power
1:48.695 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, spear_of_anguish, potion_of_prolonged_power
1:50.434 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:51.308 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
1:53.049 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:54.531 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.4/125: 76% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:55.642 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.4/125: 86% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:56.753 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.235 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.716 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.5/125: 47% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.198 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.311 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:03.422 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:04.904 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:06.016 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.128 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.240 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.351 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.463 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.576 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:13.028 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:14.118 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:15.206 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:16.296 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.746 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.225 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.705 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.817 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.297 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.6/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.777 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.255 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:27.365 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:28.847 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.957 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.437 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.917 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.397 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.509 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.990 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.103 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.215 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.7/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:40.696 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:42.176 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.288 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.767 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.246 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.9/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.729 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.9/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.210 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.9/125: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.320 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.9/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.431 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.913 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:54.364 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.3/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:55.814 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.902 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.991 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.2/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.444 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.534 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.2/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:02.014 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.2/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.494 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 52.2/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.606 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:05.695 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.783 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.2/125: 67% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.872 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.2/125: 77% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.322 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.411 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.500 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.589 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.678 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.678 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.129 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.581 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:18.061 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:19.512 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:20.964 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:22.055 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.145 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.235 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.716 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.197 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.648 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.101 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.553 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.642 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.093 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.204 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.315 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.425 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.537 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.018 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.129 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.612 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.091 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.571 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.053 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:48.533 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:49.288 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:50.400 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.512 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.992 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:54.471 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.583 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.7/125: 86% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.695 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.8/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.175 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.8/125: 34% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:59.626 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.078 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.530 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.8/125: 89% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.620 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.711 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.802 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.914 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.025 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.136 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:10.247 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:11.728 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.838 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:13.613 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:14.386 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish
4:15.416 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish
4:16.445 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish
4:17.219 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.9/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:18.248 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.9/125: 98% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:19.005 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:20.015 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.2/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:21.026 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.2/125: 57% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:21.784 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.2/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:22.541 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:23.550 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish
4:24.577 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish
4:25.608 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, spear_of_anguish
4:27.347 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:28.654 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:30.394 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:31.700 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:33.119 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.230 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.682 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:37.134 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.223 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.9/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.675 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.126 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.576 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.029 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:45.117 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:46.568 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:48.020 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:49.472 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:50.923 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.035 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.516 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.998 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.110 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.589 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.068 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.7/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60314 58083 47992 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60314 58083 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Thurible"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=spectral_thurible,id=147018,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=47992
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Tome : 1295258 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1295258.1 1295258.1 961.0 / 0.074% 303409.8 / 23.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Tome 1295258
Earth Shock 298439 23.0% 51.4 5.67sec 1742177 1695854 Direct 51.4 1236035 3570662 1742146 21.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.39 51.39 0.00 0.00 1.0273 0.0000 89530915.57 89530915.57 0.00 1695853.99 1695853.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.25 78.32% 1236034.84 773651 1683114 1235658.38 1018251 1456739 49748357 49748357 0.00
crit 11.14 21.68% 3570662.24 2221925 4833903 3569335.56 2504109 4686347 39782559 39782559 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 132666 10.2% 11.3 27.11sec 3514003 3450722 Direct 11.3 93792 273497 226782 74.0%  
Periodic 220.9 51723 206481 168555 75.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 220.89 220.89 1.0184 1.3498 39800626.91 39800626.91 0.00 128518.05 3450721.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.94 26.00% 93792.27 84126 102491 93358.38 0 102491 276182 276182 0.00
crit 8.38 74.00% 273497.31 241610 294354 273555.95 260186 285397 2292366 2292366 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.1 24.51% 51722.58 713 56371 51733.34 48363 53821 2800118 2800118 0.00
crit 166.8 75.49% 206481.08 470 226657 206489.56 196944 213505 34431962 34431962 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14069 1.1% 5.1 60.37sec 820740 0 Periodic 48.8 71522 145977 86538 20.2% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.14 0.00 48.77 48.77 0.0000 1.2312 4220414.19 4220414.19 0.00 70289.86 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.9 79.83% 71522.49 75 76542 71510.05 66511 76542 2784618 2784618 0.00
crit 9.8 20.17% 145976.60 152 156146 145959.51 0 156146 1435796 1435796 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 329203 (481899) 25.4% (37.2%) 99.1 2.97sec 1458071 1152729 Direct 98.9 0 998157 998157 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.15 98.94 0.00 0.00 1.2649 0.0000 98759144.22 98759144.22 0.00 1152729.01 1152729.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.94 100.00% 998156.52 796550 1256746 996591.27 921307 1063628 98759144 98759144 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 137680 10.6% 52.1 5.59sec 793423 0 Direct 51.9 0 795536 795536 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.06 51.92 0.00 0.00 0.0000 0.0000 41303338.03 41303338.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.92 100.00% 795535.67 634806 1001556 794302.67 715265 864996 41303338 41303338 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 15016 1.2% 73.8 3.78sec 61067 0 Direct 73.8 49680 101371 61069 22.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.77 73.77 0.00 0.00 0.0000 0.0000 4504721.06 4504721.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.52 77.97% 49680.36 47804 52945 49679.74 48199 51821 2857432 2857432 0.00
crit 16.25 22.03% 101371.29 97520 108007 101370.20 97520 107201 1647289 1647289 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 90930 (165931) 7.0% (12.8%) 76.5 3.88sec 650659 499077 Direct 76.5 256560 729192 356569 21.2%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.50 76.50 0.00 0.00 1.3037 0.0000 27278816.84 27278816.84 0.00 499077.10 499077.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.32 78.84% 256560.06 166737 609408 257883.79 211088 349677 15474537 15474537 0.00
crit 16.19 21.16% 729191.62 478867 1750220 732486.57 492549 1430685 11804280 11804280 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 75001 5.8% 72.8 5.18sec 309262 0 Direct 72.8 222658 632621 309257 21.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.75 72.75 0.00 0.00 0.0000 0.0000 22499631.82 22499631.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.38 78.87% 222658.44 140059 511903 223423.36 164723 336956 12776628 12776628 0.00
crit 15.37 21.13% 632621.11 402249 1470185 634658.01 416949 1225108 9723004 9723004 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 261477 / 176639
Fire Blast 225886 11.8% 93.0 3.18sec 492156 248694 Direct 93.0 405124 810361 492164 21.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.02 93.02 0.00 0.00 1.9790 0.0000 45782778.48 45782778.48 0.00 248693.75 248693.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.05 78.52% 405124.23 387163 428803 405157.46 396061 416738 29592640 29592640 0.00
crit 19.98 21.48% 810360.81 774326 857606 810418.80 786762 857606 16190139 16190139 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 35591 1.9% 10.4 30.30sec 693265 496379 Direct 10.4 119857 239805 146280 22.0%  
Periodic 108.9 43017 85965 52250 21.5% 69.4%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.40 10.40 108.88 108.88 1.3967 1.9124 7209908.69 7209908.69 0.00 32368.59 496379.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.11 77.98% 119856.71 114715 127053 119865.65 115506 126104 972071 972071 0.00
crit 2.29 22.02% 239804.67 229430 254106 221895.06 0 254106 549073 549073 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.5 78.50% 43017.01 21 47645 43021.22 41322 44988 3676667 3676667 0.00
crit 23.4 21.50% 85965.02 67 95290 85970.11 71954 93004 2012098 2012098 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 192109 / 25616
Lightning Blast 192109 2.0% 38.5 6.72sec 199347 199983 Direct 38.5 165688 331429 199348 20.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.55 38.55 0.00 0.00 0.9968 0.0000 7684341.54 7684341.54 0.00 199982.86 199982.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.72 79.69% 165687.82 159326 176462 165688.31 161180 173289 5089878 5089878 0.00
crit 7.83 20.31% 331429.39 318653 352924 331396.04 0 352924 2594464 2594464 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Tome
Ascendance 2.0 185.47sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 97.09sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 0.00 0.00 0.00 1.0771 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.62sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8597 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.71sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5089 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.2sec 49.2sec 27.66% 47.85% 0.0(0.0) 5.8

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.18% 32.18% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.2sec 69.2sec 8.65% 8.65% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.6 52.6 4.4sec 2.5sec 67.57% 71.28% 52.6(60.3) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.46%
  • elemental_focus_2:39.11%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 21.3 0.8 13.5sec 13.1sec 8.06% 23.67% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.06%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.95% 29.95% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.5sec 69.5sec 13.43% 13.43% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.5sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.3 34.2sec 18.9sec 37.93% 33.27% 6.3(17.5) 0.6

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.12%
  • power_of_the_maelstrom_2:6.11%
  • power_of_the_maelstrom_3:25.71%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 9.99% 10.80% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.09%
  • stormkeeper_2:2.98%
  • stormkeeper_3:3.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.19% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 22.0 13.1sec
Lava Surge: Wasted 0.8 83.9sec
Lava Surge: During Lava Burst 7.8 34.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6280.0007.6482.1570.0009.228
Fire Elemental0.4170.0011.7380.6240.0003.947
Ascendance5.9460.00163.8665.8340.00063.866
Lava Burst0.7970.00010.0185.2940.00022.538

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Tome
earth_shock Maelstrom 51.4 5166.9 100.5 100.5 17327.6
flame_shock Maelstrom 11.3 207.5 18.3 18.3 191791.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.15 1163.23 (21.42%) 11.73 26.60 2.24%
Lava Burst Overload Maelstrom 52.06 445.84 (8.21%) 8.56 22.71 4.85%
Lightning Bolt Maelstrom 76.50 612.01 (11.27%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 72.75 433.58 (7.98%) 5.96 2.92 0.67%
Aftershock Maelstrom 62.72 1612.34 (29.69%) 25.71 0.00 0.00%
Resonance Totem Maelstrom 298.58 291.04 (5.36%) 0.97 7.54 2.53%
The Deceiver's Blood Pact Maelstrom 10.26 872.77 (16.07%) 85.03 158.12 15.34%
Resource RPS-Gain RPS-Loss
Maelstrom 18.10 17.91
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.03 10.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Whispers + Tome Damage Per Second
Count 24999
Mean 1295258.12
Minimum 1024550.18
Maximum 1622742.96
Spread ( max - min ) 598192.78
Range [ ( max - min ) / 2 * 100% ] 23.09%
Standard Deviation 77526.6985
5th Percentile 1172339.56
95th Percentile 1426767.64
( 95th Percentile - 5th Percentile ) 254428.07
Mean Distribution
Standard Deviation 490.3317
95.00% Confidence Intervall ( 1294297.08 - 1296219.15 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 138
0.1% Error 13763
0.1 Scale Factor Error with Delta=300 51308138
0.05 Scale Factor Error with Delta=300 205232550
0.01 Scale Factor Error with Delta=300 5130813730
Priority Target DPS
Sample Data Whispers + Tome Priority Target Damage Per Second
Count 24999
Mean 1295258.12
Minimum 1024550.18
Maximum 1622742.96
Spread ( max - min ) 598192.78
Range [ ( max - min ) / 2 * 100% ] 23.09%
Standard Deviation 77526.6985
5th Percentile 1172339.56
95th Percentile 1426767.64
( 95th Percentile - 5th Percentile ) 254428.07
Mean Distribution
Standard Deviation 490.3317
95.00% Confidence Intervall ( 1294297.08 - 1296219.15 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 138
0.1% Error 13763
0.1 Scale Factor Error with Delta=300 51308138
0.05 Scale Factor Error with Delta=300 205232550
0.01 Scale Factor Error with Delta=300 5130813730
DPS(e)
Sample Data Whispers + Tome Damage Per Second (Effective)
Count 24999
Mean 1295258.12
Minimum 1024550.18
Maximum 1622742.96
Spread ( max - min ) 598192.78
Range [ ( max - min ) / 2 * 100% ] 23.09%
Damage
Sample Data Whispers + Tome Damage
Count 24999
Mean 327897608.64
Minimum 255043615.71
Maximum 409064654.86
Spread ( max - min ) 154021039.15
Range [ ( max - min ) / 2 * 100% ] 23.49%
DTPS
Sample Data Whispers + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.96 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.14 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.50 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.03 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.37 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 99.45 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.76 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 31.36 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.92 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 51.58 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLILLLLLILLLLLLILLLNPPPLNILQMQQNNQLLNPPPNQQLLNQQQNLQAJQNQLQMQLNNLQQNNQLLNQLQ97NLQMQQLLNQQQLLNOQLQLLNQAQJLKKKILMLQLNQQQLNQQQQNQLLNNLLLLLILGLNPPPLNQQQNHLAQQJLLNQQQFLLL9IILLLLLIILLLLLIGLILLLLLLI8LLNPPLNIIALMPJLNQQQLNQQLQLNQQQQLMNNILLLLLILLLL9LILLLNIM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:03.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.223 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.062 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.900 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.737 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.575 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:08.693 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.833 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.625 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:11.378 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:12.171 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:12.963 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:13.754 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:14.547 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:15.339 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.7/125: 95% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:16.093 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:16.885 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:17.678 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:18.470 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:19.263 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.1/125: 70% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:20.056 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.1/125: 88% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:20.848 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:21.602 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
0:22.359 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, extracted_sanity, potion_of_prolonged_power
0:23.698 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, extracted_sanity, potion_of_prolonged_power
0:25.038 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, extracted_sanity, potion_of_prolonged_power
0:26.043 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.9/125: 20% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:27.383 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:28.723 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.9/125: 44% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:30.063 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.918 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.9/125: 88% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.775 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.629 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.770 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.908 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.764 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.903 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.042 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.897 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.9/125: 86% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.752 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:40.544 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:41.296 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:42.325 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:43.099 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:44.128 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:45.157 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:46.167 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:46.923 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:47.934 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:48.944 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:49.704 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:50.713 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:51.471 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:53.177 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:54.883 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:56.591 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:57.875 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.4/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:59.581 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.062 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.062 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.172 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.284 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.396 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.3/125: 21% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.506 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.987 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:08.075 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:09.165 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.617 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.3/125: 53% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:11.705 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:12.793 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.7/125: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:13.884 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
1:15.336 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
1:16.788 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
1:18.240 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.2/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
1:19.329 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.4/125: 93% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
1:20.419 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
1:21.870 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:23.348 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.2/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:24.828 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:25.939 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.6/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.420 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.530 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.011 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:31.122 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:31.122 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.235 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.3/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:33.716 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:35.197 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:36.307 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:37.788 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:39.268 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.381 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.861 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.3/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:42.973 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.8/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.453 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.932 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.415 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.525 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.005 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.8/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.119 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.874 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:53.325 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:54.413 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.1/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:55.866 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.1/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:57.318 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:58.407 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.1/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:59.499 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:00.951 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.951 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.400 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.487 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.598 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.687 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.776 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.866 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.956 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.408 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.497 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:12.949 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.401 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:15.490 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:16.580 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:18.030 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
2:19.060 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
2:20.091 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
2:21.119 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
2:21.893 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.1/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
2:22.923 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
2:23.951 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
2:24.981 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:26.011 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:26.784 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.3/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:27.812 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:28.843 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:29.617 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:30.923 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:32.229 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:33.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:35.710 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:37.016 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.2/125: 73% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:38.758 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.2/125: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.238 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.350 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.831 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.944 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.425 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.536 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.5/125: 18% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.017 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.499 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.950 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.402 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.491 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.941 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.393 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.873 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.986 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.099 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.8/125: 13% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.581 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 29.8/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.581 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.8/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.061 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.542 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.767 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.248 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.8/125: 73% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.360 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.471 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.583 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.694 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.174 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.1/125: 70% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:15.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.1/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:17.135 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:18.246 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:19.357 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:20.471 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:21.583 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:23.064 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:24.544 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:25.996 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.087 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.177 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.266 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.809 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.896 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.348 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.828 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.918 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.008 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:39.459 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.548 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.000 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.481 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.961 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.074 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.554 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.035 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.147 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.901 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.381 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.491 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.605 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.7/125: 21% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.084 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.565 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.047 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.157 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.270 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.383 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.494 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.604 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.086 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.198 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.679 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.768 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:10.858 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:11.947 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:13.036 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.7/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:14.488 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.7/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:15.601 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.2/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:17.081 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:18.562 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:19.675 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:21.158 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:22.638 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.2/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:23.748 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.6/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:25.230 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:26.711 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.191 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.671 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.152 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.6/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.265 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:33.355 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.7/125: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.445 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.532 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:36.983 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:38.434 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:39.916 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:41.394 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:42.874 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.985 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.096 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.057 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.168 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.280 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.758 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.868 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.980 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.461 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.942 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.053 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.165 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 63458 61227 50986 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 63458 61227 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.00
# gear_stamina=46429
# gear_intellect=50986
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

baseline : 1102313 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1102312.7 1102312.7 769.5 / 0.070% 241450.5 / 21.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 48.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 1102313
Earth Shock 257249 23.3% 49.2 5.91sec 1567762 1466040 Direct 49.2 1139529 3276333 1567801 20.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.23 49.23 0.00 0.00 1.0694 0.0000 77173834.08 77173834.08 0.00 1466040.43 1466040.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.36 79.96% 1139529.47 706341 1550899 1139160.28 965538 1329736 44853780 44853780 0.00
crit 9.86 20.04% 3276332.93 2028612 4454181 3273860.15 2309462 4454181 32320054 32320054 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 113878 10.3% 11.3 27.11sec 3016285 2892573 Direct 11.3 85806 251110 204597 71.9%  
Periodic 211.8 47293 189434 150345 72.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 211.83 211.83 1.0428 1.4075 34164174.51 34164174.51 0.00 110223.37 2892572.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.19 28.14% 85805.59 76807 94440 85559.97 0 91888 273459 273459 0.00
crit 8.14 71.86% 251109.53 220589 271232 251166.07 240507 262625 2043918 2043918 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.3 27.50% 47292.72 32 51943 47300.50 44244 49417 2754920 2754920 0.00
crit 153.6 72.50% 189434.07 760 208852 189459.77 180865 196525 29091878 29091878 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 284513 (416423) 25.8% (37.8%) 95.1 3.14sec 1313507 997362 Direct 94.9 0 899282 899282 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.11 94.91 0.00 0.00 1.3170 0.0000 85353041.17 85353041.17 0.00 997362.16 997362.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 94.91 100.00% 899282.34 727248 1089103 897910.43 834746 965220 85353041 85353041 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 118896 10.8% 49.9 5.88sec 714875 0 Direct 49.8 0 716746 716746 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.89 49.76 0.00 0.00 0.0000 0.0000 35668638.07 35668638.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.76 100.00% 716746.36 579576 867954 715665.47 652498 778228 35668638 35668638 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13013 1.2% 70.9 3.98sec 55024 0 Direct 70.9 45531 92875 55023 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.95 70.95 0.00 0.00 0.0000 0.0000 3903915.21 3903915.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.72 79.95% 45530.94 43645 48786 45531.15 43991 47480 2582644 2582644 0.00
crit 14.23 20.05% 92874.59 89037 99524 92873.53 89037 98314 1321271 1321271 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 79535 (145652) 7.2% (13.2%) 73.0 3.99sec 598394 438301 Direct 73.0 237299 683146 326752 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.02 73.02 0.00 0.00 1.3653 0.0000 23860108.89 23860108.89 0.00 438300.77 438300.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.37 79.93% 237298.91 152230 561537 238485.42 193401 363338 13850977 13850977 0.00
crit 14.65 20.07% 683146.30 437205 1612735 686047.17 455080 1428973 10009131 10009131 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 66117 6.0% 70.1 5.33sec 283027 0 Direct 70.1 205414 591875 283016 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.08 70.08 0.00 0.00 0.0000 0.0000 19834532.83 19834532.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.01 79.92% 205413.75 127873 471691 206075.07 150616 292126 11504587 11504587 0.00
crit 14.07 20.08% 591875.41 367252 1354697 593590.76 384163 1120455 8329946 8329946 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 227672 / 146611
Fire Blast 196297 11.5% 85.0 3.42sec 446405 216388 Direct 85.0 371868 743761 446407 20.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.95 84.95 0.00 0.00 2.0630 0.0000 37924083.95 37924083.95 0.00 216387.56 216387.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.93 79.96% 371867.68 353479 395119 371888.36 363167 382957 25259661 25259661 0.00
crit 17.03 20.04% 743761.32 706958 790238 743804.62 717635 779889 12664423 12664423 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 31376 1.8% 10.0 31.35sec 607816 423844 Direct 10.0 109999 219962 132155 20.1%  
Periodic 100.0 39504 79016 47437 20.1% 66.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.97 9.97 99.98 99.98 1.4341 1.9980 6060118.82 6060118.82 0.00 28310.90 423843.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.96 79.86% 109998.99 104735 117072 110006.02 104735 116123 875812 875812 0.00
crit 2.01 20.14% 219962.24 209469 234145 196360.65 0 234145 441751 441751 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.9 79.92% 39504.50 13597 43902 39505.28 38220 41161 3156631 3156631 0.00
crit 20.1 20.08% 79015.88 27193 87804 79015.03 66862 85965 1585925 1585925 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.309000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 168740 / 22500
Lightning Blast 168740 2.0% 37.0 7.03sec 182422 174589 Direct 37.0 151832 303751 182424 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6749597.44 6749597.44 0.00 174588.66 174588.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.55 79.87% 151832.10 145465 162600 151832.32 147173 159164 4486657 4486657 0.00
crit 7.45 20.13% 303750.67 290929 325201 303691.14 0 325201 2262940 2262940 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
Ascendance 2.0 186.17sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 102.35sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.86 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.65sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.3sec 50.3sec 26.86% 46.17% 0.0(0.0) 5.6

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.25% 32.25% 3.1(3.1) 8.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.1 48.0 4.5sec 2.6sec 66.84% 71.63% 48.0(55.3) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.78%
  • elemental_focus_2:38.06%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 7.98% 23.54% 0.7(0.7) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 30.01% 30.01% 4.3(4.3) 12.6

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.7sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.8sec 19.7sec 37.49% 34.13% 5.9(16.2) 0.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.23%
  • power_of_the_maelstrom_2:6.25%
  • power_of_the_maelstrom_3:25.01%

Trigger Attempt Success

  • trigger_pct:15.04%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.36% 11.31% 0.0(0.0) 0.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.21%
  • stormkeeper_2:3.09%
  • stormkeeper_3:4.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.19% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 84.8sec
Lava Surge: During Lava Burst 7.5 35.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6720.0017.6752.2480.00012.680
Fire Elemental0.4140.0011.4800.5820.0003.953
Ascendance6.2880.00165.7836.2190.00065.783
Lava Burst0.8190.0009.5215.5020.00022.550

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 49.2 4963.2 100.8 100.8 15549.1
flame_shock Maelstrom 11.3 207.5 18.3 18.3 164624.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.11 1116.54 (21.36%) 11.74 24.73 2.17%
Lava Burst Overload Maelstrom 49.90 426.81 (8.17%) 8.55 22.24 4.95%
Lightning Bolt Maelstrom 73.02 584.18 (11.18%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 70.08 417.57 (7.99%) 5.96 2.91 0.69%
Aftershock Maelstrom 60.55 1551.23 (29.68%) 25.62 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.94 (5.57%) 0.97 7.64 2.56%
The Deceiver's Blood Pact Maelstrom 9.85 839.84 (16.07%) 85.23 153.47 15.45%
Resource RPS-Gain RPS-Loss
Maelstrom 17.42 17.24
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.98 12.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data baseline Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data baseline Damage Per Second
Count 24999
Mean 1102312.73
Minimum 903289.23
Maximum 1368449.26
Spread ( max - min ) 465160.03
Range [ ( max - min ) / 2 * 100% ] 21.10%
Standard Deviation 62073.7955
5th Percentile 1004024.24
95th Percentile 1208637.58
( 95th Percentile - 5th Percentile ) 204613.34
Mean Distribution
Standard Deviation 392.5970
95.00% Confidence Intervall ( 1101543.25 - 1103082.20 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12182
0.1 Scale Factor Error with Delta=300 32892757
0.05 Scale Factor Error with Delta=300 131571027
0.01 Scale Factor Error with Delta=300 3289275656
Priority Target DPS
Sample Data baseline Priority Target Damage Per Second
Count 24999
Mean 1102312.73
Minimum 903289.23
Maximum 1368449.26
Spread ( max - min ) 465160.03
Range [ ( max - min ) / 2 * 100% ] 21.10%
Standard Deviation 62073.7955
5th Percentile 1004024.24
95th Percentile 1208637.58
( 95th Percentile - 5th Percentile ) 204613.34
Mean Distribution
Standard Deviation 392.5970
95.00% Confidence Intervall ( 1101543.25 - 1103082.20 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12182
0.1 Scale Factor Error with Delta=300 32892757
0.05 Scale Factor Error with Delta=300 131571027
0.01 Scale Factor Error with Delta=300 3289275656
DPS(e)
Sample Data baseline Damage Per Second (Effective)
Count 24999
Mean 1102312.73
Minimum 903289.23
Maximum 1368449.26
Spread ( max - min ) 465160.03
Range [ ( max - min ) / 2 * 100% ] 21.10%
Damage
Sample Data baseline Damage
Count 24999
Mean 279958244.76
Minimum 222871926.17
Maximum 349704428.23
Spread ( max - min ) 126832502.06
Range [ ( max - min ) / 2 * 100% ] 22.65%
DTPS
Sample Data baseline Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data baseline Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data baseline Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data baseline Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data baseline Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data baseline Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data baselineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data baseline Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.86 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.45 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 19.29 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 95.40 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.80 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 29.93 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.47 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 48.58 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGPPPEKKKHKKKKKKKHHKKKKHKOOMOPKMLPPPPPKMPPPMKOOOMMKKKIKKKHKJJJFMKKPMPPKK97MOOOKMKKKKKLKHHKOOMNKOPMMPKIJJJHLKPPMPPKOMOOKKMHPPPKMLPPPKMPPPKKMPPPKGMOOIJKMHPKKK9HJKKKKGKHKEKKKKKHKKKKHKKKKH8KKKKHLOKOKMIJJMKKHHPPPKMOKLOKMOPMPKPMPPPKMPPPKMP9LPPK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:03.085 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.202 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.040 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.880 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.721 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.560 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.560 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.700 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.839 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.977 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.833 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.689 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.830 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.968 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.108 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.7/125: 72% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.248 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.7/125: 82% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.388 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.7/125: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.527 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.382 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.237 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.091 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.947 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.086 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.226 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.081 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.936 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.077 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.215 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.6/125: 71% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.069 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.209 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.349 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.489 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.345 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.201 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.341 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.479 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.619 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.759 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.897 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:42.015 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.7/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:43.105 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:44.557 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:46.009 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.460 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.573 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.052 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.535 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.015 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.496 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.606 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.4/125: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.717 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.171 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
0:59.622 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.073 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.165 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.619 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.2/125: 73% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.099 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.2/125: 91% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.578 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.693 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.173 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.284 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.397 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.508 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.620 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.731 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.2/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.211 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.322 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.2/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.774 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.865 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.316 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.767 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.857 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.337 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.426 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.426 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.514 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.1/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.965 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.1/125: 34% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.416 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.1/125: 46% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.896 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.378 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.1/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.491 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.974 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.8/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.452 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:38.932 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.8/125: 71% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.412 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.8/125: 82% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.891 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:43.003 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.8/125: 90% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.484 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.596 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:46.709 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.189 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.669 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.150 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.261 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.016 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.496 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.974 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.6/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.457 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.568 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.1/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:59.657 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:01.109 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:02.562 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:03.652 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:04.741 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.6/125: 69% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.852 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.6/125: 86% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.964 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.076 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.188 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.670 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.152 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.631 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.742 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.221 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.702 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.182 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.662 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.4/125: 69% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.774 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.255 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.735 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.847 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.329 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.441 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.553 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.033 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.514 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.994 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.475 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.589 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.699 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.178 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.658 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.137 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.617 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.728 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.4/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.209 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.690 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.4/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.171 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.4/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.283 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.4/125: 75% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.736 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.4/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.827 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.2/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.279 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.2/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.732 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.2/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.212 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.693 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.2/125: 77% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.805 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.2/125: 74% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.915 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.394 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.875 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 53.8/125: 43% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.986 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.096 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.578 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.8/125: 77% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.691 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.802 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.915 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.027 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.507 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.619 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.731 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.842 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.954 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.8/125: 42% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.435 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom ascendance, lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.547 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.8/125: 71% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.026 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.8/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.505 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.8/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.594 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.8/125: 89% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.046 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.8/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.136 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.587 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.587 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:30.039 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:31.128 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.607 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.087 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.567 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.679 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.158 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.270 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.751 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.230 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.341 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:44.822 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:46.303 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.9/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:47.783 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.9/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.265 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.9/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:50.377 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.132 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.613 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.091 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.572 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.682 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.793 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.906 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.387 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.498 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.7/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.978 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.458 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.7/125: 70% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.569 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 27.8/125: 22% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.680 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.791 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.904 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.016 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.8/125: 74% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.129 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.8/125: 92% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.609 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.721 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.833 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.944 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.396 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:18.847 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:20.300 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:21.391 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:22.871 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:23.983 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.093 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.8/125: 55% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:26.573 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:28.055 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.8/125: 78% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.165 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.646 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.127 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.240 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.719 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.200 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.9/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:37.680 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.793 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:40.275 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.755 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.9/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.235 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.715 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.825 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.306 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.788 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.269 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.9/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.750 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.9/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.839 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.290 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.379 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.469 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.5/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:57.921 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.401 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 940.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.86
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Simulation & Raid Information

Iterations: 25063
Threads: 64
Confidence: 95.00%
Fight Length (fixed time): 296 - 304 ( 300.0 )

Performance:

Total Events Processed: 1200018027
Max Event Queue: 561
Sim Seconds: 7518935
CPU Seconds: 2281.3785
Physical Seconds: 48.0055
Speed Up: 3296

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Charm + Sentinel Charm + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.36sec 0 300.00sec
Charm + Sentinel Charm + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel earth_shock 8042 85211987 284039 10.33 1199085 3445332 51.7 51.7 20.0% 0.0% 0.0% 0.0% 5.67sec 85211987 300.00sec
Charm + Sentinel Charm + Sentinel fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 99.86sec 0 300.00sec
Charm + Sentinel Charm + Sentinel flame_shock 188389 2453312 8178 2.27 90020 262765 11.3 11.3 73.2% 0.0% 0.0% 0.0% 27.14sec 37517820 300.00sec
Charm + Sentinel Charm + Sentinel flame_shock ticks -188389 35064507 116882 43.48 49611 198867 11.3 217.4 74.8% 0.0% 0.0% 0.0% 27.14sec 37517820 300.00sec
Charm + Sentinel Charm + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel lava_burst 51505 92994860 309981 19.67 0 945635 98.6 98.3 100.0% 0.0% 0.0% 0.0% 3.02sec 92994860 300.00sec
Charm + Sentinel Charm + Sentinel lava_burst_overload 77451 44321021 147736 11.76 0 753679 59.0 58.8 100.0% 0.0% 0.0% 0.0% 5.00sec 44321021 300.00sec
Charm + Sentinel Charm + Sentinel volcanic_inferno 205533 4223542 14078 14.66 47703 97307 73.3 73.3 20.0% 0.0% 0.0% 0.0% 3.84sec 4223542 300.00sec
Charm + Sentinel Charm + Sentinel lightning_bolt 188196 25011685 83372 14.64 248384 714535 73.2 73.2 20.0% 0.0% 0.0% 0.0% 4.02sec 25011685 300.00sec
Charm + Sentinel Charm + Sentinel lightning_bolt_overload 45284 22421943 74739 15.17 214693 617426 75.8 75.8 20.1% 0.0% 0.0% 0.0% 5.01sec 22421943 300.00sec
Charm + Sentinel Charm + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.46sec 0 300.00sec
Charm + Sentinel Charm + Sentinel spectral_blast 246442 5908682 19696 7.22 135409 276235 36.1 36.1 20.0% 0.0% 0.0% 0.0% 7.37sec 5908682 300.00sec
Charm + Sentinel Charm + Sentinel spectral_bolt 242571 12894878 42983 18.38 116064 236771 91.9 91.9 20.1% 0.0% 0.0% 0.0% 2.86sec 12894878 300.00sec
Charm + Sentinel Charm + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.00sec
Charm + Sentinel Charm + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.56sec 0 300.00sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental fire_blast 57984 42602560 212840 27.33 389107 778157 91.2 91.2 20.1% 0.0% 0.0% 0.0% 3.24sec 42602560 200.16sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental immolate 118297 1422444 7106 3.08 115112 230217 10.3 10.3 20.1% 0.0% 0.0% 0.0% 30.66sec 6700373 200.16sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental immolate ticks -118297 5277929 17593 21.25 41373 82766 10.3 106.2 20.1% 0.0% 0.0% 0.0% 30.66sec 6700373 200.16sec
Charm + Sentinel Charm + Sentinel_greater_lightning_elemental lightning_blast 191726 7099997 177500 55.76 159001 318067 37.2 37.2 20.1% 0.0% 0.0% 0.0% 7.00sec 7099997 40.00sec
Charm + Terror Charm + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.35sec 0 300.00sec
Charm + Terror Charm + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror earth_shock 8042 86719261 289063 10.10 1194337 3429256 50.5 50.5 23.4% 0.0% 0.0% 0.0% 5.77sec 86719261 300.00sec
Charm + Terror Charm + Terror fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 98.11sec 0 300.00sec
Charm + Terror Charm + Terror flame_shock 188389 2488473 8295 2.27 90096 262688 11.3 11.3 75.1% 0.0% 0.0% 0.0% 27.11sec 38124634 300.00sec
Charm + Terror Charm + Terror flame_shock ticks -188389 35636161 118787 43.55 49652 198314 11.3 217.7 76.7% 0.0% 0.0% 0.0% 27.11sec 38124634 300.00sec
Charm + Terror Charm + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror lava_burst 51505 94516270 315053 19.68 0 960594 98.6 98.4 100.0% 0.0% 0.0% 0.0% 3.01sec 94516270 300.00sec
Charm + Terror Charm + Terror lava_burst_overload 77451 39479588 131598 10.31 0 765662 51.7 51.6 100.0% 0.0% 0.0% 0.0% 5.69sec 39479588 300.00sec
Charm + Terror Charm + Terror volcanic_inferno 205533 4355390 14518 14.70 47692 97299 73.5 73.5 23.3% 0.0% 0.0% 0.0% 3.83sec 4355390 300.00sec
Charm + Terror Charm + Terror lightning_bolt 188196 26507603 88358 14.88 247690 713016 74.4 74.4 23.4% 0.0% 0.0% 0.0% 3.95sec 26507603 300.00sec
Charm + Terror Charm + Terror lightning_bolt_overload 45284 21952738 73175 14.24 214396 617279 71.2 71.2 23.3% 0.0% 0.0% 0.0% 5.24sec 21952738 300.00sec
Charm + Terror Charm + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.62sec 0 300.00sec
Charm + Terror Charm + Terror terror_from_below 242524 15276048 50920 1.99 1233906 2517168 9.9 9.9 23.6% 0.0% 0.0% 0.0% 28.62sec 15276048 300.00sec
Charm + Terror Charm + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.53sec 0 300.00sec
Charm + Terror Charm + Terror_primal_fire_elemental fire_blast 57984 44535776 218757 27.36 388892 777770 92.8 92.8 23.4% 0.0% 0.0% 0.0% 3.19sec 44535776 203.59sec
Charm + Terror Charm + Terror_primal_fire_elemental immolate 118297 1479055 7265 3.07 115041 230116 10.4 10.4 23.3% 0.0% 0.0% 0.0% 30.23sec 6975405 203.59sec
Charm + Terror Charm + Terror_primal_fire_elemental immolate ticks -118297 5496350 18321 21.57 41332 82655 10.4 107.8 23.3% 0.0% 0.0% 0.0% 30.23sec 6975405 203.59sec
Charm + Terror Charm + Terror_greater_lightning_elemental lightning_blast 191726 7294534 182363 55.75 158993 318031 37.2 37.2 23.4% 0.0% 0.0% 0.0% 7.00sec 7294534 40.00sec
Charm + Thurible Charm + Thurible ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.41sec 0 300.00sec
Charm + Thurible Charm + Thurible augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible earth_shock 8042 85127800 283758 10.11 1225139 3515587 50.5 50.5 20.1% 0.0% 0.0% 0.0% 5.77sec 85127800 300.00sec
Charm + Thurible Charm + Thurible fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 99.66sec 0 300.00sec
Charm + Thurible Charm + Thurible flame_shock 188389 2516247 8387 2.26 92357 269723 11.3 11.3 73.3% 0.0% 0.0% 0.0% 27.13sec 38560206 300.00sec
Charm + Thurible Charm + Thurible flame_shock ticks -188389 36043959 120147 43.55 50924 204079 11.3 217.7 74.8% 0.0% 0.0% 0.0% 27.13sec 38560206 300.00sec
Charm + Thurible Charm + Thurible flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible lava_burst 51505 95455755 318184 19.68 0 970108 98.6 98.4 100.0% 0.0% 0.0% 0.0% 3.02sec 95455755 300.00sec
Charm + Thurible Charm + Thurible lava_burst_overload 77451 39865314 132884 10.31 0 773226 51.7 51.6 100.0% 0.0% 0.0% 0.0% 5.71sec 39865314 300.00sec
Charm + Thurible Charm + Thurible volcanic_inferno 205533 4342893 14476 14.68 48953 99857 73.4 73.4 20.1% 0.0% 0.0% 0.0% 3.84sec 4342893 300.00sec
Charm + Thurible Charm + Thurible lightning_bolt 188196 26017902 86726 14.88 253689 731459 74.4 74.4 20.1% 0.0% 0.0% 0.0% 3.93sec 26017902 300.00sec
Charm + Thurible Charm + Thurible lightning_bolt_overload 45284 21549142 71830 14.24 219666 633872 71.2 71.2 20.0% 0.0% 0.0% 0.0% 5.22sec 21549142 300.00sec
Charm + Thurible Charm + Thurible piercing_anguish 246751 9693426 32311 3.29 487076 993635 16.6 16.5 20.2% 0.0% 0.0% 0.0% 17.68sec 9693426 300.00sec
Charm + Thurible Charm + Thurible potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.00sec
Charm + Thurible Charm + Thurible totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.88sec 0 300.00sec
Charm + Thurible Charm + Thurible_primal_fire_elemental fire_blast 57984 43784090 218474 27.34 399314 798610 91.3 91.3 20.1% 0.0% 0.0% 0.0% 3.24sec 43784090 200.41sec
Charm + Thurible Charm + Thurible_primal_fire_elemental immolate 118297 1458422 7277 3.08 118131 236252 10.3 10.3 20.0% 0.0% 0.0% 0.0% 30.73sec 6879870 200.41sec
Charm + Thurible Charm + Thurible_primal_fire_elemental immolate ticks -118297 5421448 18071 21.28 42437 84870 10.3 106.4 20.1% 0.0% 0.0% 0.0% 30.73sec 6879870 200.41sec
Charm + Thurible Charm + Thurible_greater_lightning_elemental lightning_blast 191726 7286034 182151 55.75 163210 326456 37.2 37.2 20.1% 0.0% 0.0% 0.0% 7.00sec 7286034 40.00sec
Charm + Tome Charm + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.27sec 0 300.00sec
Charm + Tome Charm + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome earth_shock 8042 88366911 294555 10.04 1254888 3590795 50.2 50.2 21.6% 0.0% 0.0% 0.0% 5.79sec 88366911 300.00sec
Charm + Tome Charm + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 98.91sec 0 300.00sec
Charm + Tome Charm + Tome flame_shock 188389 2599192 8664 2.27 94566 275738 11.3 11.3 74.3% 0.0% 0.0% 0.0% 27.11sec 39459228 300.00sec
Charm + Tome Charm + Tome flame_shock ticks -188389 36860035 122867 43.30 52133 208490 11.3 216.5 75.5% 0.0% 0.0% 0.0% 27.11sec 39459228 300.00sec
Charm + Tome Charm + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome insidious_corruption ticks -243941 4011336 13371 9.40 70570 144124 5.0 47.0 20.1% 0.0% 0.0% 0.0% 63.20sec 4011336 300.00sec
Charm + Tome Charm + Tome lava_burst 51505 97611622 325371 19.58 0 996926 98.1 97.9 100.0% 0.0% 0.0% 0.0% 3.02sec 97611622 300.00sec
Charm + Tome Charm + Tome lava_burst_overload 77451 40747599 135825 10.26 0 794490 51.4 51.3 100.0% 0.0% 0.0% 0.0% 5.71sec 40747599 300.00sec
Charm + Tome Charm + Tome volcanic_inferno 205533 4474070 14913 14.61 50065 102126 73.1 73.1 21.5% 0.0% 0.0% 0.0% 3.82sec 4474070 300.00sec
Charm + Tome Charm + Tome lightning_bolt 188196 26879196 89597 14.76 262071 732360 73.8 73.8 21.7% 0.0% 0.0% 0.0% 4.01sec 26879196 300.00sec
Charm + Tome Charm + Tome lightning_bolt_overload 45284 22268430 74228 14.15 226794 633364 70.8 70.8 21.6% 0.0% 0.0% 0.0% 5.29sec 22268430 300.00sec
Charm + Tome Charm + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.58sec 0 300.00sec
Charm + Tome Charm + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.75sec 0 300.00sec
Charm + Tome Charm + Tome_primal_fire_elemental fire_blast 57984 45461222 225733 27.24 408264 816395 91.4 91.4 21.8% 0.0% 0.0% 0.0% 3.24sec 45461222 201.39sec
Charm + Tome Charm + Tome_primal_fire_elemental immolate 118297 1517720 7536 3.08 120775 241422 10.4 10.4 21.4% 0.0% 0.0% 0.0% 30.58sec 7133859 201.39sec
Charm + Tome Charm + Tome_primal_fire_elemental immolate ticks -118297 5616139 18720 21.27 43418 86829 10.4 106.3 21.6% 0.0% 0.0% 0.0% 30.58sec 7133859 201.39sec
Charm + Tome Charm + Tome_greater_lightning_elemental lightning_blast 191726 7423656 185591 55.50 166900 333847 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.03sec 7423656 40.00sec
Sentinel + Terror Sentinel + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.31sec 0 300.00sec
Sentinel + Terror Sentinel + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror earth_shock 8042 83041825 276805 10.07 1146935 3292730 50.4 50.4 23.4% 0.0% 0.0% 0.0% 5.79sec 83041825 300.00sec
Sentinel + Terror Sentinel + Terror fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 100.39sec 0 300.00sec
Sentinel + Terror Sentinel + Terror flame_shock 188389 2346433 7821 2.26 85851 250989 11.3 11.3 73.5% 0.0% 0.0% 0.0% 27.13sec 34681654 300.00sec
Sentinel + Terror Sentinel + Terror flame_shock ticks -188389 32335222 107784 42.37 47324 188813 11.3 211.8 74.4% 0.0% 0.0% 0.0% 27.13sec 34681654 300.00sec
Sentinel + Terror Sentinel + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror lava_burst 51505 86970318 289900 19.02 0 914308 95.3 95.1 100.0% 0.0% 0.0% 0.0% 3.09sec 86970318 300.00sec
Sentinel + Terror Sentinel + Terror lava_burst_overload 77451 41469525 138231 11.38 0 728729 57.1 56.9 100.0% 0.0% 0.0% 0.0% 5.13sec 41469525 300.00sec
Sentinel + Terror Sentinel + Terror volcanic_inferno 205533 4017498 13392 14.21 45527 92887 71.0 71.0 23.3% 0.0% 0.0% 0.0% 3.97sec 4017498 300.00sec
Sentinel + Terror Sentinel + Terror lightning_bolt 188196 24696820 82322 14.38 238777 687160 71.9 71.9 23.4% 0.0% 0.0% 0.0% 4.12sec 24696820 300.00sec
Sentinel + Terror Sentinel + Terror lightning_bolt_overload 45284 22117649 73725 14.91 206266 593971 74.5 74.5 23.3% 0.0% 0.0% 0.0% 5.12sec 22117649 300.00sec
Sentinel + Terror Sentinel + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.43sec 0 300.00sec
Sentinel + Terror Sentinel + Terror spectral_blast 246442 6120386 20401 7.26 135409 276235 36.3 36.3 23.5% 0.0% 0.0% 0.0% 7.34sec 6120386 300.00sec
Sentinel + Terror Sentinel + Terror spectral_bolt 242571 13277397 44258 18.40 116064 236771 92.0 92.0 23.4% 0.0% 0.0% 0.0% 2.86sec 13277397 300.00sec
Sentinel + Terror Sentinel + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.68sec 0 300.00sec
Sentinel + Terror Sentinel + Terror terror_from_below 242524 14842189 49474 1.94 1233906 2517168 9.7 9.7 23.3% 0.0% 0.0% 0.0% 28.95sec 14842189 300.00sec
Sentinel + Terror Sentinel + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.89sec 0 300.00sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental fire_blast 57984 39570902 201363 26.35 371710 743415 86.3 86.3 23.4% 0.0% 0.0% 0.0% 3.39sec 39570902 196.52sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental immolate 118297 1373655 6990 3.09 109954 219950 10.1 10.1 23.4% 0.0% 0.0% 0.0% 30.97sec 6309618 196.52sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental immolate ticks -118297 4935962 16453 20.27 39498 78986 10.1 101.3 23.3% 0.0% 0.0% 0.0% 30.97sec 6309618 196.52sec
Sentinel + Terror Sentinel + Terror_greater_lightning_elemental lightning_blast 191726 6936820 173421 55.50 151823 303690 37.0 37.0 23.5% 0.0% 0.0% 0.0% 7.03sec 6936820 40.00sec
Sentinel + Tome Sentinel + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.39sec 0 300.00sec
Sentinel + Tome Sentinel + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome earth_shock 8042 85340393 284467 10.08 1206477 3454785 50.4 50.4 21.6% 0.0% 0.0% 0.0% 5.76sec 85340393 300.00sec
Sentinel + Tome Sentinel + Tome fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 101.26sec 0 300.00sec
Sentinel + Tome Sentinel + Tome flame_shock 188389 2452250 8174 2.26 90330 264051 11.3 11.3 72.7% 0.0% 0.0% 0.0% 27.10sec 36181007 300.00sec
Sentinel + Tome Sentinel + Tome flame_shock ticks -188389 33728757 112429 42.37 49803 198931 11.3 211.8 73.4% 0.0% 0.0% 0.0% 27.10sec 36181007 300.00sec
Sentinel + Tome Sentinel + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome insidious_corruption ticks -243941 4008609 13362 9.40 70598 143943 5.0 47.0 20.0% 0.0% 0.0% 0.0% 60.51sec 4008609 300.00sec
Sentinel + Tome Sentinel + Tome lava_burst 51505 90574113 301912 19.03 0 952124 95.3 95.1 100.0% 0.0% 0.0% 0.0% 3.11sec 90574113 300.00sec
Sentinel + Tome Sentinel + Tome lava_burst_overload 77451 43195957 143986 11.38 0 758877 57.1 56.9 100.0% 0.0% 0.0% 0.0% 5.15sec 43195957 300.00sec
Sentinel + Tome Sentinel + Tome volcanic_inferno 205533 4156580 13855 14.18 47898 97711 70.9 70.9 21.6% 0.0% 0.0% 0.0% 3.94sec 4156580 300.00sec
Sentinel + Tome Sentinel + Tome lightning_bolt 188196 25213042 84043 14.38 252274 707528 71.9 71.9 21.6% 0.0% 0.0% 0.0% 4.11sec 25213042 300.00sec
Sentinel + Tome Sentinel + Tome lightning_bolt_overload 45284 22591794 75306 14.91 218110 609354 74.6 74.6 21.7% 0.0% 0.0% 0.0% 5.13sec 22591794 300.00sec
Sentinel + Tome Sentinel + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.40sec 0 300.00sec
Sentinel + Tome Sentinel + Tome spectral_blast 246442 5947248 19824 7.26 135409 276235 36.3 36.3 20.2% 0.0% 0.0% 0.0% 7.38sec 5947248 300.00sec
Sentinel + Tome Sentinel + Tome spectral_bolt 242571 12911471 43038 18.40 116064 236771 92.0 92.0 20.1% 0.0% 0.0% 0.0% 2.86sec 12911471 300.00sec
Sentinel + Tome Sentinel + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.67sec 0 300.00sec
Sentinel + Tome Sentinel + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.74sec 0 300.00sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental fire_blast 57984 40714739 209028 26.36 390994 781925 85.6 85.6 21.7% 0.0% 0.0% 0.0% 3.42sec 40714739 194.78sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental immolate 118297 1407626 7227 3.09 115663 231239 10.0 10.0 21.3% 0.0% 0.0% 0.0% 31.25sec 6488587 194.78sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental immolate ticks -118297 5080960 16937 20.12 41548 83118 10.0 100.6 21.5% 0.0% 0.0% 0.0% 31.25sec 6488587 194.78sec
Sentinel + Tome Sentinel + Tome_greater_lightning_elemental lightning_blast 191726 7105589 177640 55.50 159736 319552 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.03sec 7105589 40.00sec
Terror + Tome Terror + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.20sec 0 300.00sec
Terror + Tome Terror + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome earth_shock 8042 86805125 289349 9.84 1198990 3461291 49.2 49.2 25.0% 0.0% 0.0% 0.0% 5.90sec 86805125 300.00sec
Terror + Tome Terror + Tome fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 100.17sec 0 300.00sec
Terror + Tome Terror + Tome flame_shock 188389 2476996 8257 2.27 90404 263980 11.3 11.3 73.9% 0.0% 0.0% 0.0% 27.12sec 36754389 300.00sec
Terror + Tome Terror + Tome flame_shock ticks -188389 34277392 114258 42.36 49840 198241 11.3 211.8 75.5% 0.0% 0.0% 0.0% 27.12sec 36754389 300.00sec
Terror + Tome Terror + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome insidious_corruption ticks -243941 4129304 13764 9.40 70611 144179 5.1 47.0 23.4% 0.0% 0.0% 0.0% 60.40sec 4129304 300.00sec
Terror + Tome Terror + Tome lava_burst 51505 92501405 308337 19.00 0 973732 95.2 95.0 100.0% 0.0% 0.0% 0.0% 3.13sec 92501405 300.00sec
Terror + Tome Terror + Tome lava_burst_overload 77451 38615926 128719 9.95 0 776220 49.9 49.7 100.0% 0.0% 0.0% 0.0% 5.89sec 38615926 300.00sec
Terror + Tome Terror + Tome volcanic_inferno 205533 4288349 14294 14.17 47890 97712 70.9 70.9 25.3% 0.0% 0.0% 0.0% 3.97sec 4288349 300.00sec
Terror + Tome Terror + Tome lightning_bolt 188196 26553603 88512 14.58 251186 713147 72.9 72.9 24.5% 0.0% 0.0% 0.0% 4.03sec 26553603 300.00sec
Terror + Tome Terror + Tome lightning_bolt_overload 45284 22027037 73423 13.98 217277 618259 69.9 69.9 24.4% 0.0% 0.0% 0.0% 5.34sec 22027037 300.00sec
Terror + Tome Terror + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.69sec 0 300.00sec
Terror + Tome Terror + Tome terror_from_below 242524 14976151 49920 1.92 1233906 2517168 9.6 9.6 25.2% 0.0% 0.0% 0.0% 29.40sec 14976151 300.00sec
Terror + Tome Terror + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.44sec 0 300.00sec
Terror + Tome Terror + Tome_primal_fire_elemental fire_blast 57984 42436258 214115 26.34 390792 781806 87.0 87.0 24.8% 0.0% 0.0% 0.0% 3.38sec 42436258 198.19sec
Terror + Tome Terror + Tome_primal_fire_elemental immolate 118297 1477555 7455 3.09 115601 231386 10.2 10.2 25.2% 0.0% 0.0% 0.0% 30.86sec 6769539 198.19sec
Terror + Tome Terror + Tome_primal_fire_elemental immolate ticks -118297 5291984 17640 20.41 41548 83017 10.2 102.0 24.9% 0.0% 0.0% 0.0% 30.86sec 6769539 198.19sec
Terror + Tome Terror + Tome_greater_lightning_elemental lightning_blast 191726 7306736 182668 55.50 159736 319503 37.0 37.0 23.6% 0.0% 0.0% 0.0% 7.04sec 7306736 40.00sec
Thurible + Sentinel Thurible + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.04sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel earth_shock 8042 81476797 271588 10.07 1175654 3374556 50.4 50.4 20.1% 0.0% 0.0% 0.0% 5.78sec 81476797 300.00sec
Thurible + Sentinel Thurible + Sentinel fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 102.02sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel flame_shock 188389 2375368 7918 2.26 88021 257690 11.3 11.3 71.8% 0.0% 0.0% 0.0% 27.13sec 35075681 300.00sec
Thurible + Sentinel Thurible + Sentinel flame_shock ticks -188389 32700313 109001 42.37 48527 194423 11.3 211.8 72.5% 0.0% 0.0% 0.0% 27.13sec 35075681 300.00sec
Thurible + Sentinel Thurible + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel lava_burst 51505 87947850 293158 19.04 0 923739 95.4 95.2 100.0% 0.0% 0.0% 0.0% 3.11sec 87947850 300.00sec
Thurible + Sentinel Thurible + Sentinel lava_burst_overload 77451 41899452 139664 11.38 0 736282 57.1 56.9 100.0% 0.0% 0.0% 0.0% 5.16sec 41899452 300.00sec
Thurible + Sentinel Thurible + Sentinel volcanic_inferno 205533 4011232 13371 14.21 46725 95321 71.1 71.1 20.0% 0.0% 0.0% 0.0% 3.94sec 4011232 300.00sec
Thurible + Sentinel Thurible + Sentinel lightning_bolt 188196 24197675 80659 14.37 244645 703514 71.9 71.9 20.1% 0.0% 0.0% 0.0% 4.09sec 24197675 300.00sec
Thurible + Sentinel Thurible + Sentinel lightning_bolt_overload 45284 21635652 72119 14.90 211279 606727 74.5 74.5 20.0% 0.0% 0.0% 0.0% 5.09sec 21635652 300.00sec
Thurible + Sentinel Thurible + Sentinel piercing_anguish 246751 9415901 31386 3.20 487076 993635 16.1 16.0 20.1% 0.0% 0.0% 0.0% 18.32sec 9415901 300.00sec
Thurible + Sentinel Thurible + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.40sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_blast 246442 6102138 20340 7.26 138975 283509 36.3 36.3 20.2% 0.0% 0.0% 0.0% 7.34sec 6102138 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_bolt 242571 13250242 44167 18.40 119121 243007 92.0 92.0 20.1% 0.0% 0.0% 0.0% 2.86sec 13250242 300.00sec
Thurible + Sentinel Thurible + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.67sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.61sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental fire_blast 57984 38974725 201453 26.38 381665 763385 85.0 85.0 20.1% 0.0% 0.0% 0.0% 3.41sec 38974725 193.47sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental immolate 118297 1352740 6992 3.09 112887 225734 10.0 10.0 20.1% 0.0% 0.0% 0.0% 31.26sec 6223540 193.47sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental immolate ticks -118297 4870800 16236 20.01 40545 81104 10.0 100.1 20.0% 0.0% 0.0% 0.0% 31.26sec 6223540 193.47sec
Thurible + Sentinel Thurible + Sentinel_greater_lightning_elemental lightning_blast 191726 6927319 173183 55.50 155815 311752 37.0 37.0 20.1% 0.0% 0.0% 0.0% 7.04sec 6927319 40.00sec
Thurible + Terror Thurible + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.35sec 0 300.00sec
Thurible + Terror Thurible + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror earth_shock 8042 82814865 276048 9.84 1171528 3362815 49.2 49.2 23.4% 0.0% 0.0% 0.0% 5.94sec 82814865 300.00sec
Thurible + Terror Thurible + Terror fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 100.81sec 0 300.00sec
Thurible + Terror Thurible + Terror flame_shock 188389 2409842 8033 2.27 88124 257637 11.3 11.3 73.5% 0.0% 0.0% 0.0% 27.13sec 35585479 300.00sec
Thurible + Terror Thurible + Terror flame_shock ticks -188389 33175637 110585 42.36 48573 193787 11.3 211.8 74.4% 0.0% 0.0% 0.0% 27.13sec 35585479 300.00sec
Thurible + Terror Thurible + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror lava_burst 51505 89081573 296937 19.00 0 937707 95.2 95.0 100.0% 0.0% 0.0% 0.0% 3.11sec 89081573 300.00sec
Thurible + Terror Thurible + Terror lava_burst_overload 77451 37251654 124172 9.97 0 747476 50.0 49.8 100.0% 0.0% 0.0% 0.0% 5.86sec 37251654 300.00sec
Thurible + Terror Thurible + Terror volcanic_inferno 205533 4115183 13717 14.18 46724 95326 70.9 70.9 23.3% 0.0% 0.0% 0.0% 3.92sec 4115183 300.00sec
Thurible + Terror Thurible + Terror lightning_bolt 188196 25616005 85386 14.58 244296 701532 72.9 72.9 23.4% 0.0% 0.0% 0.0% 4.04sec 25616005 300.00sec
Thurible + Terror Thurible + Terror lightning_bolt_overload 45284 21302010 71006 14.00 211363 607927 70.0 70.0 23.4% 0.0% 0.0% 0.0% 5.34sec 21302010 300.00sec
Thurible + Terror Thurible + Terror piercing_anguish 246751 9710200 32367 3.20 487076 993635 16.2 16.0 23.6% 0.0% 0.0% 0.0% 18.46sec 9710200 300.00sec
Thurible + Terror Thurible + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.67sec 0 300.00sec
Thurible + Terror Thurible + Terror terror_from_below 242524 15161217 50537 1.93 1266400 2583456 9.6 9.6 23.4% 0.0% 0.0% 0.0% 29.65sec 15161217 300.00sec
Thurible + Terror Thurible + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.88sec 0 300.00sec
Thurible + Terror Thurible + Terror_primal_fire_elemental fire_blast 57984 40615409 206758 26.35 381495 763018 86.3 86.3 23.4% 0.0% 0.0% 0.0% 3.39sec 40615409 196.44sec
Thurible + Terror Thurible + Terror_primal_fire_elemental immolate 118297 1408862 7172 3.09 112841 225698 10.1 10.1 23.4% 0.0% 0.0% 0.0% 31.05sec 6474590 196.44sec
Thurible + Terror Thurible + Terror_primal_fire_elemental immolate ticks -118297 5065729 16886 20.26 40536 81072 10.1 101.3 23.4% 0.0% 0.0% 0.0% 31.05sec 6474590 196.44sec
Thurible + Terror Thurible + Terror_greater_lightning_elemental lightning_blast 191726 7120070 178002 55.50 155847 311796 37.0 37.0 23.5% 0.0% 0.0% 0.0% 7.03sec 7120070 40.00sec
Thurible + Tome Thurible + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.47sec 0 300.00sec
Thurible + Tome Thurible + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome earth_shock 8042 85235731 284118 9.83 1229571 3552219 49.2 49.2 21.7% 0.0% 0.0% 0.0% 5.90sec 85235731 300.00sec
Thurible + Tome Thurible + Tome fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 101.92sec 0 300.00sec
Thurible + Tome Thurible + Tome flame_shock 188389 2505892 8353 2.26 92736 270997 11.3 11.3 72.1% 0.0% 0.0% 0.0% 27.10sec 37145768 300.00sec
Thurible + Tome Thurible + Tome flame_shock ticks -188389 34639876 115466 42.37 51118 204102 11.3 211.8 73.5% 0.0% 0.0% 0.0% 27.10sec 37145768 300.00sec
Thurible + Tome Thurible + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome insidious_corruption ticks -243941 4122291 13741 9.40 72474 147980 5.1 47.0 20.1% 0.0% 0.0% 0.0% 60.42sec 4122291 300.00sec
Thurible + Tome Thurible + Tome lava_burst 51505 93435769 311451 18.99 0 983942 95.2 95.0 100.0% 0.0% 0.0% 0.0% 3.14sec 93435769 300.00sec
Thurible + Tome Thurible + Tome lava_burst_overload 77451 39047697 130158 9.96 0 784223 49.9 49.8 100.0% 0.0% 0.0% 0.0% 5.95sec 39047697 300.00sec
Thurible + Tome Thurible + Tome volcanic_inferno 205533 4275918 14253 14.15 49152 100293 70.7 70.7 22.1% 0.0% 0.0% 0.0% 3.99sec 4275918 300.00sec
Thurible + Tome Thurible + Tome lightning_bolt 188196 26071728 86905 14.60 257141 729382 73.0 73.0 21.2% 0.0% 0.0% 0.0% 4.01sec 26071728 300.00sec
Thurible + Tome Thurible + Tome lightning_bolt_overload 45284 21651252 72171 14.01 222455 632999 70.0 70.0 21.1% 0.0% 0.0% 0.0% 5.31sec 21651252 300.00sec
Thurible + Tome Thurible + Tome piercing_anguish 246751 9539051 31797 3.20 487076 993635 16.1 16.0 21.7% 0.0% 0.0% 0.0% 18.53sec 9539051 300.00sec
Thurible + Tome Thurible + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.69sec 0 300.00sec
Thurible + Tome Thurible + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.57sec 0 300.00sec
Thurible + Tome Thurible + Tome_primal_fire_elemental fire_blast 57984 41776143 214381 26.36 401232 802648 85.6 85.6 21.6% 0.0% 0.0% 0.0% 3.42sec 41776143 194.87sec
Thurible + Tome Thurible + Tome_primal_fire_elemental immolate 118297 1452694 7455 3.09 118681 237550 10.0 10.0 21.8% 0.0% 0.0% 0.0% 31.25sec 6669646 194.87sec
Thurible + Tome Thurible + Tome_primal_fire_elemental immolate ticks -118297 5216953 17390 20.13 42651 85192 10.0 100.7 21.6% 0.0% 0.0% 0.0% 31.25sec 6669646 194.87sec
Thurible + Tome Thurible + Tome_greater_lightning_elemental lightning_blast 191726 7292262 182307 55.50 163926 327968 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.04sec 7292262 40.00sec
Whispers + Charm Whispers + Charm ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.86sec 0 300.00sec
Whispers + Charm Whispers + Charm augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm earth_shock 8042 89254047 297512 10.53 1231837 3538086 52.7 52.7 20.1% 0.0% 0.0% 0.0% 5.53sec 89254047 300.00sec
Whispers + Charm Whispers + Charm fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 97.30sec 0 300.00sec
Whispers + Charm Whispers + Charm flame_shock 188389 2564573 8549 2.27 93453 272116 11.3 11.3 74.4% 0.0% 0.0% 0.0% 27.14sec 40906790 300.00sec
Whispers + Charm Whispers + Charm flame_shock ticks -188389 38342217 127807 45.43 51522 206004 11.3 227.1 75.9% 0.0% 0.0% 0.0% 27.14sec 40906790 300.00sec
Whispers + Charm Whispers + Charm flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm lava_burst 51505 100407244 334689 20.42 0 983447 102.3 102.1 100.0% 0.0% 0.0% 0.0% 2.91sec 100407244 300.00sec
Whispers + Charm Whispers + Charm lava_burst_overload 77451 41950252 139834 10.70 0 783802 53.7 53.5 100.0% 0.0% 0.0% 0.0% 5.53sec 41950252 300.00sec
Whispers + Charm Whispers + Charm volcanic_inferno 205533 4553976 15180 15.23 49480 100938 76.2 76.2 20.1% 0.0% 0.0% 0.0% 3.74sec 4553976 300.00sec
Whispers + Charm Whispers + Charm lightning_bolt 188196 27247541 90825 15.63 253162 729343 78.1 78.1 20.1% 0.0% 0.0% 0.0% 3.76sec 27247541 300.00sec
Whispers + Charm Whispers + Charm lightning_bolt_overload 45284 22387408 74624 14.80 219820 632703 74.0 74.0 20.0% 0.0% 0.0% 0.0% 5.04sec 22387408 300.00sec
Whispers + Charm Whispers + Charm potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.61sec 0 300.00sec
Whispers + Charm Whispers + Charm totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.75sec 0 300.00sec
Whispers + Charm Whispers + Charm_primal_fire_elemental fire_blast 57984 47238149 230963 28.62 403366 806735 97.6 97.6 20.0% 0.0% 0.0% 0.0% 3.05sec 47238149 204.53sec
Whispers + Charm Whispers + Charm_primal_fire_elemental immolate 118297 1500736 7338 3.07 119343 238672 10.5 10.5 20.0% 0.0% 0.0% 0.0% 30.16sec 7334086 204.53sec
Whispers + Charm Whispers + Charm_primal_fire_elemental immolate ticks -118297 5833349 19444 22.67 42861 85738 10.5 113.3 20.1% 0.0% 0.0% 0.0% 30.16sec 7334086 204.53sec
Whispers + Charm Whispers + Charm_greater_lightning_elemental lightning_blast 191726 7720785 193020 58.44 164972 330001 39.0 39.0 20.1% 0.0% 0.0% 0.0% 6.68sec 7720785 40.00sec
Whispers + Sentinel Whispers + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.75sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel earth_shock 8042 85789351 285963 10.53 1184295 3399413 52.6 52.6 20.1% 0.0% 0.0% 0.0% 5.53sec 85789351 300.00sec
Whispers + Sentinel Whispers + Sentinel fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 97.75sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel flame_shock 188389 2439504 8132 2.27 89268 260560 11.3 11.3 73.6% 0.0% 0.0% 0.0% 27.11sec 37637299 300.00sec
Whispers + Sentinel Whispers + Sentinel flame_shock ticks -188389 35197795 117326 44.18 49210 197034 11.3 220.9 74.5% 0.0% 0.0% 0.0% 27.11sec 37637299 300.00sec
Whispers + Sentinel Whispers + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel lava_burst 51505 92934499 309780 19.81 0 938363 99.3 99.0 100.0% 0.0% 0.0% 0.0% 2.99sec 92934499 300.00sec
Whispers + Sentinel Whispers + Sentinel lava_burst_overload 77451 44333839 147779 11.86 0 747829 59.4 59.3 100.0% 0.0% 0.0% 0.0% 4.99sec 44333839 300.00sec
Whispers + Sentinel Whispers + Sentinel volcanic_inferno 205533 4219321 14064 14.76 47310 96512 73.8 73.8 20.0% 0.0% 0.0% 0.0% 3.82sec 4219321 300.00sec
Whispers + Sentinel Whispers + Sentinel lightning_bolt 188196 25382647 84608 15.10 244402 701949 75.5 75.5 20.1% 0.0% 0.0% 0.0% 3.90sec 25382647 300.00sec
Whispers + Sentinel Whispers + Sentinel lightning_bolt_overload 45284 22596613 75322 15.53 211497 608394 77.6 77.6 20.0% 0.0% 0.0% 0.0% 4.88sec 22596613 300.00sec
Whispers + Sentinel Whispers + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel spectral_blast 246442 5967580 19892 7.29 135409 276235 36.5 36.5 20.1% 0.0% 0.0% 0.0% 7.30sec 5967580 300.00sec
Whispers + Sentinel Whispers + Sentinel spectral_bolt 242571 13490417 44968 19.23 116064 236771 96.2 96.2 20.1% 0.0% 0.0% 0.0% 2.74sec 13490417 300.00sec
Whispers + Sentinel Whispers + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.60sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.81sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel_primal_fire_elemental fire_blast 57984 42783173 212809 27.55 386032 772071 92.3 92.3 20.1% 0.0% 0.0% 0.0% 3.20sec 42783173 201.04sec
Whispers + Sentinel Whispers + Sentinel_primal_fire_elemental immolate 118297 1416371 7045 3.08 114179 228371 10.3 10.3 20.1% 0.0% 0.0% 0.0% 30.49sec 6737487 201.04sec
Whispers + Sentinel Whispers + Sentinel_primal_fire_elemental immolate ticks -118297 5321117 17737 21.63 40971 81974 10.3 108.2 20.1% 0.0% 0.0% 0.0% 30.49sec 6737487 201.04sec
Whispers + Sentinel Whispers + Sentinel_greater_lightning_elemental lightning_blast 191726 7309294 182732 57.85 157797 315667 38.6 38.6 20.1% 0.0% 0.0% 0.0% 6.73sec 7309294 40.00sec
Whispers + Terror Whispers + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.10sec 0 300.00sec
Whispers + Terror Whispers + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror earth_shock 8042 87145550 290484 10.28 1179546 3385285 51.4 51.4 23.4% 0.0% 0.0% 0.0% 5.64sec 87145550 300.00sec
Whispers + Terror Whispers + Terror fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 96.50sec 0 300.00sec
Whispers + Terror Whispers + Terror flame_shock 188389 2473953 8246 2.27 89319 260516 11.3 11.3 75.3% 0.0% 0.0% 0.0% 27.13sec 38173466 300.00sec
Whispers + Terror Whispers + Terror flame_shock ticks -188389 35699514 118998 44.19 49245 196479 11.3 220.9 76.3% 0.0% 0.0% 0.0% 27.13sec 38173466 300.00sec
Whispers + Terror Whispers + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror lava_burst 51505 94223965 314078 19.77 0 953104 99.1 98.9 100.0% 0.0% 0.0% 0.0% 3.00sec 94223965 300.00sec
Whispers + Terror Whispers + Terror lava_burst_overload 77451 39384135 131280 10.37 0 759528 52.0 51.9 100.0% 0.0% 0.0% 0.0% 5.66sec 39384135 300.00sec
Whispers + Terror Whispers + Terror volcanic_inferno 205533 4336851 14456 14.75 47312 96515 73.8 73.8 23.3% 0.0% 0.0% 0.0% 3.81sec 4336851 300.00sec
Whispers + Terror Whispers + Terror lightning_bolt 188196 26876424 89588 15.32 243905 701662 76.6 76.6 23.4% 0.0% 0.0% 0.0% 3.82sec 26876424 300.00sec
Whispers + Terror Whispers + Terror lightning_bolt_overload 45284 22155479 73851 14.55 211586 609077 72.8 72.8 23.4% 0.0% 0.0% 0.0% 5.11sec 22155479 300.00sec
Whispers + Terror Whispers + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.00sec
Whispers + Terror Whispers + Terror terror_from_below 242524 14813514 49378 1.93 1233906 2517168 9.7 9.7 23.4% 0.0% 0.0% 0.0% 29.35sec 14813514 300.00sec
Whispers + Terror Whispers + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.69sec 0 300.00sec
Whispers + Terror Whispers + Terror_primal_fire_elemental fire_blast 57984 44591490 218514 27.54 385886 771752 93.7 93.7 23.4% 0.0% 0.0% 0.0% 3.17sec 44591490 204.07sec
Whispers + Terror Whispers + Terror_primal_fire_elemental immolate 118297 1473942 7223 3.08 114162 228360 10.5 10.5 23.4% 0.0% 0.0% 0.0% 30.18sec 7008596 204.07sec
Whispers + Terror Whispers + Terror_primal_fire_elemental immolate ticks -118297 5534653 18449 21.90 40966 81910 10.5 109.5 23.4% 0.0% 0.0% 0.0% 30.18sec 7008596 204.07sec
Whispers + Terror Whispers + Terror_greater_lightning_elemental lightning_blast 191726 7506479 187662 57.82 157823 315695 38.5 38.5 23.4% 0.0% 0.0% 0.0% 6.76sec 7506479 40.00sec
Whispers + Thurible Whispers + Thurible ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.19sec 0 300.00sec
Whispers + Thurible Whispers + Thurible augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible earth_shock 8042 85472366 284907 10.28 1209168 3470613 51.4 51.4 20.1% 0.0% 0.0% 0.0% 5.69sec 85472366 300.00sec
Whispers + Thurible Whispers + Thurible fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 98.16sec 0 300.00sec
Whispers + Thurible Whispers + Thurible flame_shock 188389 2503136 8344 2.27 91573 267449 11.3 11.3 73.5% 0.0% 0.0% 0.0% 27.11sec 38604300 300.00sec
Whispers + Thurible Whispers + Thurible flame_shock ticks -188389 36101164 120337 44.19 50499 202208 11.3 220.9 74.4% 0.0% 0.0% 0.0% 27.11sec 38604300 300.00sec
Whispers + Thurible Whispers + Thurible flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible lava_burst 51505 95149771 317164 19.77 0 962575 99.1 98.8 100.0% 0.0% 0.0% 0.0% 3.00sec 95149771 300.00sec
Whispers + Thurible Whispers + Thurible lava_burst_overload 77451 39803109 132676 10.38 0 767169 52.0 51.9 100.0% 0.0% 0.0% 0.0% 5.68sec 39803109 300.00sec
Whispers + Thurible Whispers + Thurible volcanic_inferno 205533 4322447 14408 14.73 48560 99062 73.6 73.6 20.1% 0.0% 0.0% 0.0% 3.80sec 4322447 300.00sec
Whispers + Thurible Whispers + Thurible lightning_bolt 188196 26351503 87838 15.33 249763 718611 76.6 76.6 20.1% 0.0% 0.0% 0.0% 3.85sec 26351503 300.00sec
Whispers + Thurible Whispers + Thurible lightning_bolt_overload 45284 21717237 72390 14.55 216879 623330 72.8 72.8 20.1% 0.0% 0.0% 0.0% 5.14sec 21717237 300.00sec
Whispers + Thurible Whispers + Thurible piercing_anguish 246751 9457340 31524 3.21 487076 993635 16.2 16.1 20.2% 0.0% 0.0% 0.0% 18.06sec 9457340 300.00sec
Whispers + Thurible Whispers + Thurible potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.61sec 0 300.00sec
Whispers + Thurible Whispers + Thurible totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.74sec 0 300.00sec
Whispers + Thurible Whispers + Thurible_primal_fire_elemental fire_blast 57984 43861176 218450 27.56 396196 792341 92.2 92.2 20.1% 0.0% 0.0% 0.0% 3.20sec 43861176 200.78sec
Whispers + Thurible Whispers + Thurible_primal_fire_elemental immolate 118297 1453222 7238 3.08 117199 234416 10.3 10.3 20.2% 0.0% 0.0% 0.0% 30.55sec 6908437 200.78sec
Whispers + Thurible Whispers + Thurible_primal_fire_elemental immolate ticks -118297 5455215 18184 21.61 42050 84114 10.3 108.1 20.0% 0.0% 0.0% 0.0% 30.55sec 6908437 200.78sec
Whispers + Thurible Whispers + Thurible_greater_lightning_elemental lightning_blast 191726 7500758 187519 57.85 161940 324013 38.6 38.6 20.1% 0.0% 0.0% 0.0% 6.76sec 7500758 40.00sec
Whispers + Tome Whispers + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.47sec 0 300.00sec
Whispers + Tome Whispers + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome earth_shock 8042 89530916 298435 10.28 1236035 3570662 51.4 51.4 21.7% 0.0% 0.0% 0.0% 5.67sec 89530916 300.00sec
Whispers + Tome Whispers + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 97.09sec 0 300.00sec
Whispers + Tome Whispers + Tome flame_shock 188389 2568547 8562 2.27 93792 273497 11.3 11.3 74.0% 0.0% 0.0% 0.0% 27.11sec 39800627 300.00sec
Whispers + Tome Whispers + Tome flame_shock ticks -188389 37232080 124107 44.18 51723 206481 11.3 220.9 75.5% 0.0% 0.0% 0.0% 27.11sec 39800627 300.00sec
Whispers + Tome Whispers + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome insidious_corruption ticks -243941 4220414 14068 9.75 71522 145977 5.1 48.8 20.2% 0.0% 0.0% 0.0% 60.37sec 4220414 300.00sec
Whispers + Tome Whispers + Tome lava_burst 51505 98759144 329196 19.79 0 998157 99.1 98.9 100.0% 0.0% 0.0% 0.0% 2.97sec 98759144 300.00sec
Whispers + Tome Whispers + Tome lava_burst_overload 77451 41303338 137677 10.38 0 795536 52.1 51.9 100.0% 0.0% 0.0% 0.0% 5.59sec 41303338 300.00sec
Whispers + Tome Whispers + Tome volcanic_inferno 205533 4504721 15016 14.75 49680 101371 73.8 73.8 22.0% 0.0% 0.0% 0.0% 3.78sec 4504721 300.00sec
Whispers + Tome Whispers + Tome lightning_bolt 188196 27278817 90929 15.30 256560 729192 76.5 76.5 21.2% 0.0% 0.0% 0.0% 3.88sec 27278817 300.00sec
Whispers + Tome Whispers + Tome lightning_bolt_overload 45284 22499632 74998 14.55 222658 632621 72.8 72.8 21.1% 0.0% 0.0% 0.0% 5.18sec 22499632 300.00sec
Whispers + Tome Whispers + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.62sec 0 300.00sec
Whispers + Tome Whispers + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.71sec 0 300.00sec
Whispers + Tome Whispers + Tome_primal_fire_elemental fire_blast 57984 45782778 225882 27.54 405124 810361 93.0 93.0 21.5% 0.0% 0.0% 0.0% 3.18sec 45782778 202.68sec
Whispers + Tome Whispers + Tome_primal_fire_elemental immolate 118297 1521144 7505 3.08 119857 239805 10.4 10.4 22.0% 0.0% 0.0% 0.0% 30.30sec 7209909 202.68sec
Whispers + Tome Whispers + Tome_primal_fire_elemental immolate ticks -118297 5688765 18963 21.78 43017 85965 10.4 108.9 21.5% 0.0% 0.0% 0.0% 30.30sec 7209909 202.68sec
Whispers + Tome Whispers + Tome_greater_lightning_elemental lightning_blast 191726 7684342 192109 57.82 165688 331429 38.5 38.5 20.3% 0.0% 0.0% 0.0% 6.72sec 7684342 40.00sec
baseline baseline ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.17sec 0 300.00sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline earth_shock 8042 77173834 257245 9.85 1139529 3276333 49.2 49.2 20.0% 0.0% 0.0% 0.0% 5.91sec 77173834 300.00sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 102.35sec 0 300.00sec
baseline baseline flame_shock 188389 2317377 7725 2.27 85806 251110 11.3 11.3 71.9% 0.0% 0.0% 0.0% 27.11sec 34164175 300.00sec
baseline baseline flame_shock ticks -188389 31846798 106156 42.37 47293 189434 11.3 211.8 72.5% 0.0% 0.0% 0.0% 27.11sec 34164175 300.00sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline lava_burst 51505 85353041 284509 18.98 0 899282 95.1 94.9 100.0% 0.0% 0.0% 0.0% 3.14sec 85353041 300.00sec
baseline baseline lava_burst_overload 77451 35668638 118895 9.95 0 716746 49.9 49.8 100.0% 0.0% 0.0% 0.0% 5.88sec 35668638 300.00sec
baseline baseline volcanic_inferno 205533 3903915 13013 14.19 45531 92875 70.9 70.9 20.1% 0.0% 0.0% 0.0% 3.98sec 3903915 300.00sec
baseline baseline lightning_bolt 188196 23860109 79533 14.60 237299 683146 73.0 73.0 20.1% 0.0% 0.0% 0.0% 3.99sec 23860109 300.00sec
baseline baseline lightning_bolt_overload 45284 19834533 66115 14.02 205414 591875 70.1 70.1 20.1% 0.0% 0.0% 0.0% 5.33sec 19834533 300.00sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.65sec 0 300.00sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.64sec 0 300.00sec
baseline baseline_primal_fire_elemental fire_blast 57984 37924084 196254 26.38 371868 743761 85.0 85.0 20.0% 0.0% 0.0% 0.0% 3.42sec 37924084 193.24sec
baseline baseline_primal_fire_elemental immolate 118297 1317563 6818 3.10 109999 219962 10.0 10.0 20.1% 0.0% 0.0% 0.0% 31.35sec 6060119 193.24sec
baseline baseline_primal_fire_elemental immolate ticks -118297 4742556 15809 20.00 39504 79016 10.0 100.0 20.1% 0.0% 0.0% 0.0% 31.35sec 6060119 193.24sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 6749597 168740 55.50 151832 303751 37.0 37.0 20.1% 0.0% 0.0% 0.0% 7.03sec 6749597 40.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
20102932.3 20102932.3 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 12.35% 12.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.35%

Trigger Attempt Success

  • trigger_pct:99.99%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.07% 11.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.29% 9.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.43% 10.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 12.84% 12.84% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:12.84%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 9.45% 9.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:9.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.87% 11.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.00% 10.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.51% 6.51% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.20% 6.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.20%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 20102932.27
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24999
Mean 300.00
Minimum 295.71
Maximum 304.29
Spread ( max - min ) 8.58
Range [ ( max - min ) / 2 * 100% ] 1.43%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24999
Mean 20259260.66
Minimum 19132312.70
Maximum 21387300.97
Spread ( max - min ) 2254988.27
Range [ ( max - min ) / 2 * 100% ] 5.57%
Standard Deviation 283151.6930
5th Percentile 19795289.49
95th Percentile 20726151.94
( 95th Percentile - 5th Percentile ) 930862.44
Mean Distribution
Standard Deviation 1790.8444
95.00% Confidence Intervall ( 20255750.67 - 20262770.65 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 751
0.1 Scale Factor Error with Delta=300 684418900
0.05 Scale Factor Error with Delta=300 2737675600
0.01 Scale Factor Error with Delta=300 68441889988
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 6063681833 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.